.
The Open Protein Structure Annotation Network
PDB Keyword
.

3kwr

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Putative RNA-binding protein (NP_785364.1) from Lactobacillus plantarum at 1.45 A resolution. To be published
    Site JCSG
    PDB Id 3kwr Target Id 392319
    Molecular Characteristics
    Source Lactobacillus plantarum wcfs1
    Alias Ids TPS29481,NP_785364.1, 533679 Molecular Weight 10608.27 Da.
    Residues 96 Isoelectric Point 4.09
    Sequence mnhnyvevkypaifrdegtywdvrfpdvpaaqtfgasvqvaadnaanalaialfeqslppasdpqywrl astefvvwitmadvqfgpgadtpepmn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.45 Rfree 0.181
    Matthews' coefficent 2.64 Rfactor 0.163
    Waters 218 Solvent Content 53.43

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3kwr
    1. Bacterial toxin-antitoxin systems
    J Guglielmini, L Van Melderen - 2012 - landes.bjmu.edu.cn
     

    Protein Summary

    Pfam note: This is a member of our UPF0150 family - another class of families with unknown function. This is part of a clan that also contains DUF1902. There is not much know about either family. The only functional information we have is: 'These families are characterised by sharing a 2-layer, beta(3)-alpha-beta topol ogy. Domains dimerise via the long C-terminal strand with the formation of a sin gle beta-sheet.' And from the paper on the structure: Based on the properties and functions of structural homologues of the TTHA0281 m onomer, the TTHA0281 protein is speculated to be involved in RNA metabolism, inc luding RNA binding and cleavage. This was based on 2dsy - there may be some more functional information there.

     

     

    Gene NP_785364.1 encodes a protein with 96 residues from LACTOBACILLUS PLANTARUM with Isoelectric Point of 4.09.  The NCI blast sequence alignment can not indicate any conserved motif for this target other than hypothetic protein.   No structural homolog has been suggested by Dali sever.

     

    392319_1.png

    Fig. 1  Protein NP_785364.1 presents an unusual fold.

     

    392319_2.png

    Fig. 2  Protein NP_785364.1 presents a dimer as the possible biomolecule.

     

     

     

     

     

    Refereneces,

    1.Okazaki N, Kumei M, Manzoku M, Kuramitsu S, Shirouzu M, Shinkai A, Yokoyama S; , Acta Crystallograph Sect F Struct Biol Cryst Commun. 2007;63:173-177.: Structure of a UPF0150-family protein from Thermus thermophilus HB8.

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (2)

    FileSizeDateAttached by 
     392319_1.png
    No description
    463.51 kB23:47, 16 Sep 2009kevinjinActions
     392319_2.png
    No description
    698.04 kB23:47, 16 Sep 2009kevinjinActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch