.
The Open Protein Structure Annotation Network
PDB Keyword
.

3l2h

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Putative sugar phosphate isomerase (AFE_0303) from Acidithiobacillus ferrooxidans ATCC 23270 at 1.85 A resolution. To be published
    Site JCSG
    PDB Id 3l2h Target Id 391565
    Molecular Characteristics
    Source Acidithiobacillus ferrooxidans atcc 23270
    Alias Ids TPS14631,AFE_0303, 2.60.120.10, 88963 Molecular Weight 18195.74 Da.
    Residues 161 Isoelectric Point 6.03
    Sequence mdtrkllltaqeisrmkgehkvhflnpgavrvnkslgdavglrhmgihliqiepgkesteyhlhhyeee avyvlsgkgtltmendqypiapgdfvgfpchaaahsisndgtetlvclvigqrldqdvvdypnqhkrly rnngewnlvdmadirvlreptqk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.85 Rfree 0.210
    Matthews' coefficent 3.34 Rfactor 0.180
    Waters 736 Solvent Content 63.16

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    Gene AFE_0303 encodes a protein (YP_002220834) with 161 residues from Acidithiobacillus ferrooxidans ATCC 23270 with isoelectric point of 6.03.  The NCBI blast sequence alignment indicates that YP_002220834 contains a conserved domain belonging to Cupin2 family (PF07883) with diversified functionalities [Ref].  SCOP classifies 3l2h in the all-beta class, RmlC-like cupins superfamily, TM1287-like family. 3l2h is structurally similar (Dali Z-scr=20) to a putative sugar phosphate isomerase (PDB ID: 3I7D) and to (Dali Z-scr=10) a tetracenomycin polyketide synthesis protein from X. campestris [Ref]  (PDB IDs: 2GU9 & 3H50).  The crystal interface contacts suggest that the oligomerization state in solution of YP_002220834 is a tetramer. 

     

     

    391565_2.png

    Fig. 1  3l2h structure folds into a Cupin2 domain.

     

    391565_1.png

    Fig. 2  The biomolecule of 3l2h is a tretramer.

     

    391565_3.png

    Fig. 3  3l2h (Green) is a structurally similar to 3H50 (Yellow) and 3I7D (Magenta). 

    Ligand Summary

    Reviews

    References

     

    1. (No Results)

       


      Discuss this publication
    2. (No Results)

       


      Discuss this publication
    Tag page
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch