.
The Open Protein Structure Annotation Network
PDB Keyword
.

3l2n

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Putative carboxypeptidase A (YP_562911.1) from SHEWANELLA DENITRIFICANS OS-217 at 2.39 A resolution. To be published
    Site JCSG
    PDB Id 3l2n Target Id 375163
    Molecular Characteristics
    Source Shewanella denitrificans os217
    Alias Ids TPS20119,YP_562911.1, 3.40.630.10, 285375 Molecular Weight 42030.86 Da.
    Residues 376 Isoelectric Point 4.63
    Sequence mrisanfdggnietislanpddiqlairpdaggefyqwfnfrfeatigktytlnilnaggasylkgwed yqavasydrqtwfrlpteykdgklsisveldceaiqiayftpysyerhldlisavqlhplvstehlglt ldgrdmtlvkvgdddpskksiwitarqhpgetmaewlvegllnqlldndcptskalldkanfyivpnmn pdgsvrghlrtnavganlnrewqtpslerspevyyvvnkmhetgvdlfydvhgdeglpyvflagcegip nysdklaslqqdfvaalslasadfqtefgydkdepgkanltvacnwvantfkclsntlempfkdnanla dpfqgwspersvyfgeasliamravidkigq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.39 Rfree 0.233
    Matthews' coefficent 2.56 Rfactor 0.180
    Waters 228 Solvent Content 52.02

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3l2n
    1. The novel structure of a cytosolic M14 metallocarboxypeptidase (CCP) from Pseudomonas aeruginosa: a model for mammalian CCPs
    A Otero, MR de la Vega, S Tanco, J Lorenzo, FX Avils - The FASEB Journal, 2012 - FASEB
     

    Protein Summary

    Pfam update: peptidate M14 family

    Gene Sden_1905 from S. denitrificans encodes a putative carboxypeptidase (YP_562911.1) belonging to the peptidase M14, Zn carboxypeptidase group PF00246. SCOP classifies 3l2n in the alpha/beta class, Zn-dependent exopopetidase superfamily, pancreatic carboxypeptidase family. The 3l2n crystal structure shows a Ca ion per chain chelated by side chains of residues H166, E169 and H259.

     

    Fig1.png 

    A very similar structure (Dali Z-scr=57) solved recently at JCSG is target 375074 with PDB id 3k2k and TOPSAN page. Check the Zinc Peptidase Group page via the tag below in the tag tab for further information.

    Both these proteins, 3l2n and 3k2k, like some of the other Pfam PF00246 structures, have two domains (the extra domain being the N-terminal prelude to the CATH Zn peptidase domain), as in 3d66, 2boa and 1nsa (Dali Z-scr=26). But the primary differentiator in JCSG targets is that the N-term structure is significantly different from that of the others in the same Pfam group.

    Also, a thermal shift assay performed on this protein (expressed at 37C) shows that it binds Ca2+ in preference to Zn2+ and Ca2+ was found at the putative active site along with another unidentified ligand (UNL). The UNL resembles a glutamic or aspartic acid with the side chain atoms toward the metal and may mimic an inhibitor or natural ligand.

    Ligand Summary

     Ca2+ and UNL at the putative active site

    Reviews

    References

     

    No references found.

    Tag page

    Files (1)

    FileSizeDateAttached by 
     Fig1.png
    No description
    331.59 kB00:35, 20 Oct 2009debanuActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch