.
The Open Protein Structure Annotation Network
PDB Keyword
.

3lew

    Title Crystal structure of SusD-like carbohydrate binding protein (YP_001298396.1) from Bacteroides vulgatus ATCC 8482 at 1.70 A resolution. To be published
    Site JCSG
    PDB Id 3lew Target Id 396537
    Molecular Characteristics
    Source Bacteroides vulgatus atcc 8482
    Alias Ids TPS25925,YP_001298396.1, BIG_773, 326085 Molecular Weight 56239.78 Da.
    Residues 494 Isoelectric Point 5.24
    Sequence ldtipttyvdagsvfgktgdaekvlnggwnylmetfnsyanpgygamlrandamgsdvvlnskygfrth nefsaiygkggtntlswllayrvindcngvldnidaaegtqadrnrikgqalalrgflylhlascysfa idkdpdavcapiytqstdetiaaegkpassvsevyaqsindleealelipetyvrdakhkidnevvlgi lsraclyarqwekaktysdkllakdnylmteseykagfnsvdnkewiwghaqtndqsnasyqfhyldtt tkgsyyysfnvdpyfrdlfedgdyrkemlfwatdpgadvesaayvwmrnskfrfrdienqlgdivlmrv aeiylinaeakahlndpdainklndlktargaktihtnlsqqdlletiwlerrkelwgegfslidiirn qqtvvrnaypegpidyiytdengqthtlkkktqghrffnfpdksafcpnskyylyritdseelanknly kdhpklsiytk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.70 Rfree 0.170
    Matthews' coefficent 2.78 Rfactor 0.145
    Waters 537 Solvent Content 55.82

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    Gene BVU_1083 from Bacteroides vulgatus atcc 8482 encodes the protein YP_001298396.1 which is annotated as putative outer membrane protein, probably involved in carbohydrate binding. YP_001298396.1 belongs to the starch utilization system SusD group PF07980 [Ref]. SCOP classifies 3lew in the all-alpha class, TPR-like superfamily, SusD-like family.

     

    The monomer structure is displayed below.

    PX14367B.png

     

    Dali top hits of structures with significant similarity to 3lew are listed below.

     

    DALI Structural Homologs
    N PDB Z-score RMSD LALI NRES %ID TITLE (JCSG structures highlighted in red)
    1 3kez 39.9 2.4 418 448 24 PUTATIVE SUGAR BINDING PROTEIN
    2 3jq1 33.7 2.6 405 464 18 SUSD SUPERFAMILY PROTEIN
    3 3jys 31.5 2.8 400 479 19 SUSD SUPERFAMILY PROTEIN
    4 3hdx 31.5 2.7 386 456 18 SUSD SUPERFAMILY PROTEIN
    5 3ihv 30.7 2.7 416 535 17 SUSD HOMOLOG
    6 3iv0 30.3 2.6 387 466 20 SUSD HOMOLOG
    7 3ck7 30.0 2.8 397 497 20 SUSD
    8 3i4g 29.8 2.8 409 513 19 SUSD-LIKE CARBOHYDRATE BINDING PROTEIN BF1063
    9 3ckc 29.8 2.8 398 500 20 SUSD
    10 3ckb 29.8 2.8 400 501 19 SUSD

    Ligand Summary

    Reviews

    References

     

    1. (No Results)

       


      Discuss this publication
    Tag page

    Files (1)

    FileSizeDateAttached by 
     PX14367B.png
    No description
    141.65 kB17:41, 23 Nov 2009abhinavkActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch