The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
        1. 1.1.1. Protein Summary
    1. 2. Summary
        1. 2.1.1. Ligand Summary

    Title Crystal structure of Putative 6-phosphogluconolactonase(YP_207848.1) from Neisseria gonorrhoeae FA 1090 at 1.33 A resolution. To be Published
    Site JCSG
    PDB Id 3lhi Target Id 398990
    Molecular Characteristics
    Source Neisseria gonorrhoeae fa 1090
    Alias Ids TPS30578,YP_207848.1, _0112.001592_, 533802 Molecular Weight 24876.64 Da.
    Residues 231 Isoelectric Point 5.10
    Sequence mfvwheyenaaeaaqsladavadalqgaldekggavlavsggrspiaffnalsqkdldwknvgitlade rivptnhadsntglvreyllknkaaaavwipmvedgktetelhpdavvdyalkhykqpdvlilgmgndg htasifpkapqfqtaidgsagvalvhttpvtapherismtldaiahtghvflaiqgeekkavfdqaaqg enreypislvlnhqgvnchvfyae
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.33 Rfree 0.161
    Matthews' coefficent 2.45 Rfactor 0.132
    Waters 394 Solvent Content 49.87

    Ligand Information



    Protein Summary

    Pfam update: This structure hits Glucosamine_iso PF01182, for which there are several known structures. The family has had its seed increased and been rebuilt since release 24, and Q5F8Q1 is now in the family.

    Gene NGO0716 from Neisseria gonorrhoeae fa 1090 encodes the YP_207848.1 protein, which is 96% identical to YP_001599435, a 6-phosphogluconolactonase. So far, it does not belong to any Pfam group. A temptative SCOP assignment is inside the alpha/beta class, NagB/RpiA/CoA transferase-like superfamily, NagB-like family.




    Fig1. 3lhi is found as a monomer in the crystal structure.


    DALI search for structural similarity to 3lhi provides 1vl1 as top hit. The superposition of 3lhi with 1vl1 shows that overall structure is very similar. In the putative active site, 3lhi does not contain any ligand. However, a citric acid group (CIT) is found in the 1vl1 structure in contact with R43, H138, K190.


    Fig2. Superposition of 3lhi with the DALI top hit 1vl1.


    Dali summary is shown as below.


        No:  Chain   Z    rmsd lali nres  %id PDB  Description

    Ligand Summary




    No references found.

    Tag page

    Files (2)

    FileSizeDateAttached by 
    No description
    169.04 kB07:46, 21 Nov 2009gyewonActions
    No description
    218.18 kB07:46, 21 Nov 2009gyewonActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch