The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of putative hydrolase (YP_751971.1) from Shewanella frigidimarina NCIMB 400 at 1.80 A resolution. To be published
    Site JCSG
    PDB Id 3lho Target Id 381550
    Molecular Characteristics
    Source Shewanella frigidimarina ncimb 400
    Alias Ids TPS26511,YP_751971.1, BIG_208, 91635 Molecular Weight 29593.91 Da.
    Residues 266 Isoelectric Point 5.23
    Sequence mhtdvnalfaalwqdyikmtpsaakihqllghgapiindhialrtfniakvnlsvlakhftsigyvdsg dykfeqkkliakhfehpdpkqpkvfisellveefspevqksihglidqvdiaattadnfiysgrhwdvd katyqallaeseyaawvaalgyranhftvsindlpeferiedvnqalkqagfvlnssggevkgspevll eqsstmadkvvvnftdgdveipscfyefarrypmangqlytgfvaasadkifestnamm
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.80 Rfree 0.207
    Matthews' coefficent 2.40 Rfactor 0.173
    Waters 206 Solvent Content 48.77

    Ligand Information



    Protein Summary

    Gene Sfri_3296 from Shewanella frigidimarina ncimb 400 encodes the YP_751971 protein that lacks Pfam group. 3lho is similar to 2rjb , solved by NESG (Dali Z-scr=19) and 3iuz solved by JCSG (Dali Z-scr=25). 3lho is very likely a metal (zinc) hydrolase that might be involved in amino acid metabolism, based on its genomic context. Specifically, STRING provides a 0.626 scored hit with the arginine N-succinyltransferase YP_751973.


    Figure 1. 3lho monomer fold with bound metal (Ni)


    Figure 2. 3lho putative active site pocket (Ni depicted as white sphere)


    Figure 3. Structural superposition between 3lho (green), 3iuz (cyan)  and 2rjb (magenta)


    Ligand Summary




    No references found.

    Tag page

    Files (3)

    FileSizeDateAttached by 
    monomer of pu8578a
    129.9 kB23:41, 10 Dec 2009qxuActions
    active pocket of pu8578a
    276.66 kB23:46, 10 Dec 2009qxuActions
    structure comparison
    197.93 kB23:54, 10 Dec 2009qxuActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch