The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Putative cell adhesion protein (YP_001304840.1) from Parabacteroides distasonis ATCC 8503 at 2.05 A resolution. To be published
    Site JCSG
    PDB Id 3liu Target Id 386057
    Molecular Characteristics
    Source Parabacteroides distasonis atcc 8503
    Alias Ids TPS25714,YP_001304840.1, 164, 397331 Molecular Weight 43527.20 Da.
    Residues 401 Isoelectric Point 4.56
    Sequence ddneieipkapvlekaqlalaikseegavtktgettptdadvntltvgvfgvdgwsviytkdatpnsdg tkdvgpqevyageahvvvvanaapviqtelakakditdfiettinlsdetltkgltmsskvldvtlvan ttnyigyddevgditvkdisgkevygagpvplvrdvasialagadignpenanyesksfvlkevfiasa kgvssvasteewgtiekdffgdthfgyldykvgllfltspnnidegsykkglqtkydalakkhvendpa lnhefyvyentkgevksgesnvneayanhtllivkgdytylpqgakesitkencyyaipvgeevtidgt ekrskfyvqrnykyeisltiigpgseipydpmistnvsasvkvepwnvktiheeve
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.05 Rfree 0.219
    Matthews' coefficent 2.46 Rfactor 0.170
    Waters 590 Solvent Content 49.91

    Ligand Information



    Protein Summary

    Gene BDI_3517 from Parabacteroides distasonis atcc 8503 encodes the YP_001304840 protein that belongs to the fimbrial subunit protein A (FimA) group (PF06321). 3liu structure is related to DUF1812 3gf8, with an HHpred P-val of 1e-7, and Dali Z-scr of 11. The rmsd between the two proteins is 4.27A for 247 superimposed Ca (13% seq id).


    3liu shares significant sequence similarity with type II fimbrilin precusor of Porphyromonas gingivalis (25% seq id).


    Figure 1. 3liu monomer structure


    Ligand Summary




    No references found.

    Tag page

    Files (1)

    FileSizeDateAttached by 
    gs13813A monomer
    74.15 kB00:11, 17 Nov 2009qxuActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch