.
The Open Protein Structure Annotation Network
PDB Keyword
.

3llc

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Putative hydrolase (YP_002548124.1) from Agrobacterium vitis S4 at 1.80 A resolution. To be published
    Site JCSG
    PDB Id 3llc Target Id 401112
    Molecular Characteristics
    Source Agrobacterium vitis s4
    Alias Ids TPS29782,YP_002548124.1, 332810 Molecular Weight 29387.71 Da.
    Residues 269 Isoelectric Point 5.03
    Sequence mtnvgrpiethaitvgqgsdarsiaalvrapaqderptciwlggyrsdmtgtkalemddlaaslgvgai rfdysghgasggafrdgtisrwleealavldhfkpekailvgssmggwialrliqelkarhdnptqvsg mvliapapdftsdliepllgdreraelaengyfeevseyspepniftralmedgranrvmagmidtgcp vhilqgmadpdvpyqhalklvehlpaddvvltlvrdgdhrlsrpqdidrmrnairamieprp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.80 Rfree 0.185
    Matthews' coefficent 3.15 Rfactor 0.160
    Waters 258 Solvent Content 60.91

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3llc
    1. The structure of monoacylglycerol lipase from Bacillus sp. H257 reveals unexpected conservation of the cap architecture between bacterial and human enzymes
    S Rengachari, GA Bezerra, L Riegler-Berket - et Biophysica Acta (BBA , 2012 - Elsevier
     

    Protein Summary

    Gene Avi_0199 encodes the YP_002548124 protein which belongs to the Pfam family of alpha/beta hydrolases (PF00561). Temptative SCOP classification is inside the alpha/beta class, alpha/beta hydrolases superfamily, carbon-carbon bond hydrolase family. Pfam update: Abhydrolase_1 family.

    There are strong hits in Dali with numerous esterases and lipases like 2wtm (Z-scr=27), 3jwe (Z-scr=25), 3hju (Z-scr=24). Other proteins of similar structure (Z-score=~20) as found by Dali are a hypothetical protein (PDB id 2hdw), esterases (PDB ids 1q0r, 1y7h), and a salicylic acid binding protein (PDB id 1xkl).

     

     

     

    Fig1.png 

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (1)

    FileSizeDateAttached by 
     Fig1.png
    No description
    360.05 kB23:26, 21 Jan 2010debanuActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch