.
The Open Protein Structure Annotation Network
PDB Keyword
.

3lot

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of PROTEIN OF UNKNOWN FUNCTION (NP_070038.1) from ARCHAEOGLOBUS FULGIDUS at 1.89 A resolution. To be published
    Site JCSG
    PDB Id 3lot Target Id 381344
    Molecular Characteristics
    Source Archaeoglobus fulgidus dsm 4304
    Alias Ids TPS26504,NP_070038.1, PF05853, 86747 Molecular Weight 35088.79 Da.
    Residues 313 Isoelectric Point 5.97
    Sequence mrkddvvivtcaitgaihtpsmspylpvtpdqiveeavkaaeagagmvhihardpkdgrpttdvevfry icreikkqsdvvinvttggggtlgipveerakvvpalkpeiatfnmgsmnfaihpllkkykefkydwep eylemtrdivfrntfkdlealsrifkendtkpelecydigqiyntafmfhegylepplrlqfihgilgg igtavedvlfmkqtadrligrenytwslvgagrfqmplgtlavimggdvrvgledslyiergklaksna eqvekmvrivkelgkrpatpdevreilglkgkervnf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.89 Rfree 0.206
    Matthews' coefficent 2.14 Rfactor 0.156
    Waters 1462 Solvent Content 42.53

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3lot
    1. 3-Keto-5-aminohexanoate Cleavage Enzyme
    M Bellinzoni, K Bastard, A Perret, A Zaparucha - Journal of Biological , 2011 - ASBMB
     
    2. High Yield Recombinant Expression, Characterization and Homology Modeling of Two Types of Cis-epoxysuccinic Acid Hydrolases
    GZ Cui, S Wang, Y Li, YJ Tian, Y Feng, Q Cui - The Protein Journal, 2012 - Springer
     
    3. Computational Strategies for the Development of Novel Small Molecule Rheumatoid Arthritis Therapies
    TM Mahfouz, DH Kinder - Anti-Inflammatory &# 38; Anti-Allergy , 2011 - ingentaconnect.com
     

    Protein Summary

    Pfam note: It seems you've solved lots of proteins from this family. Including one you call 3-keto-5-aminohexanoate cleavage enzyme: PDBs: 3FA5, 3E49, 3E02, 3C6C. Doesn't sound like you need any help from us. But these should definately a high priority for you to publish.

     

    Gene AF_1210 from Archaeoglobus fulgidus encodes the NP_070038 sequence belonging to DUF849 (PF05853). STRING genome context analysis provides a 0.94 scored hit with AF_1206, a 3-hydroxyacyl-Coa dehydrogenase (NP_070034).

    3lot structure has a classical TIM barrel fold. A metal-binding site is characterized in the central channel.  A structural homolog search via Dali and SSM suggests this protein have a similar fold to 3-keto-5-aminohexanoate cleavage enzyme, which is involved in in the fermentation pathway of lysine (Kreimeyer et al. 2007).

    This protein is likely to function as a tetramer.

     

    381344_1.png

     

    According to Dali, 3lot is structurally similar to several other DUF849s solved by JCSG including 3e49 (Z-scr=51), 3e02 (Z-scr=51), 3fa5 (Z-scr=40), 3chv (Z-scr=40), and 3c6c (Z-scr=40).

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (2)

    FileSizeDateAttached by 
     381344_1.png
    No description
    1831.78 kB19:16, 14 Oct 2009kevinjinActions
     381344_2.png
    No description
    1331.9 kB08:02, 16 Mar 2010kevinjinActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch