.
The Open Protein Structure Annotation Network
PDB Keyword
.

3lwj

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Putative TetR-family transcriptional regulator (YP_752756.1) from Syntrophomonas wolfei str. Goettingen at 2.07 A resolution. To be published
    Site JCSG
    PDB Id 3lwj Target Id 399241
    Molecular Characteristics
    Source Syntrophomonas wolfei subsp. wolfei
    Alias Ids TPS30588,YP_752756.1, _0073.002805_, _0076.003088_, _0088.001719_, 324854 Molecular Weight 23359.87 Da.
    Residues 201 Isoelectric Point 5.60
    Sequence mpiplekqnkerrqkiltcsldlfiekgyyntsirdiialsevgtgtfynyfvdkedilknlledfakq iissiseyylvekdlyerfietkrltmevfaqnetlseiysrvagssapidqclkqfedrllefysrni eygikkgvfknvpvspiahsilaiekfslykwvvlkaitkeemiemvlsfhktlavgllvvnd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.07 Rfree 0.234
    Matthews' coefficent 2.15 Rfactor 0.188
    Waters 65 Solvent Content 42.78

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3lwj
    1. TetR-family transcriptional repressor Thermus thermophilus FadR controls fatty acid degradation
    Y Agari, K Agari, K Sakamoto, S Kuramitsu - , 2011 - Soc General Microbiol
     

    Protein Summary

    This protein is most likely a TetR transcription regulator. There are numerous similar structures solved by JCSG and others. This protein is now in family PF00440.16 TetR_N CL0123.

     

    Figure 1. dimer of 399241

    mi9673aq-dimer.png

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (1)

    FileSizeDateAttached by 
     mi9673aq-dimer.png
    mi9673aq
    164.12 kB23:53, 27 Jan 2010qxuActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch