.
The Open Protein Structure Annotation Network
PDB Keyword
.

3lws

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Putative aromatic amino acid beta-eliminating lyase/threonine aldolase. (YP_001813866.1) from Exiguobacterium sp. 255-15 at 2.00 A resolution. To be published
    Site JCSG
    PDB Id 3lws Target Id 390840
    Molecular Characteristics
    Source Exiguobacterium sibiricum 255-15
    Alias Ids TPS14626,YP_001813866.1, 3.40.640.10, 289370 Molecular Weight 39589.67 Da.
    Residues 356 Isoelectric Point 4.96
    Sequence mnrlrtsfqqttgqisghgkrnvgvlktafaavademasdqygtgaiiepfeqkfadvlgmddavffps gtmaqqvalriwsdetdnrtvayhplchleiheqdglkelhpietilvgaadrlmtldeikalpdiacl llelpqreiggvapafseletisrycrergirlhldgarlfemlpyyektaaeiaglfdsiyisfykgl ggiagailagpaafcqtariwkrryggdlislypyivsadyyyelrkdrmgqyyeqakqlaeqfnalpg vhttpevpvsnmfhlhfdgqaadispkleqvqeetglgfvgylvdkdgycsteisvgdaygeldqqtrd agfarlrqafs
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.00 Rfree 0.190
    Matthews' coefficent 2.48 Rfactor 0.144
    Waters 1339 Solvent Content 50.36

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3lws
    1. Distributed structure determination at the JCSG
    H van den Bedem, G Wolf, Q Xu - Section D: Biological , 2011 - scripts.iucr.org
     

    Protein Summary

    This protein is 21% identical to a previous JCSG structure 2fm1, the overall structural and active site are highly similar.

     

    Fig 1. dimer

    mg14477a.png

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (1)

    FileSizeDateAttached by 
     mg14477a.png
    mg14477a dimer
    195.97 kB23:26, 9 Feb 2010qxuActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch