The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of NTF2-like protein of unknown function (YP_270605.1) from Colwellia psychrerythraea 34H at 1.61 A resolution. To be published
    Site JCSG
    PDB Id 3lyg Target Id 402769
    Molecular Characteristics
    Source Colwellia psychrerythraea 34h
    Alias Ids TPS30754,YP_270605.1, 3.10.450.50, 322258 Molecular Weight 13605.82 Da.
    Residues 119 Isoelectric Point 4.39
    Sequence mnlanivqrgwealgagdfdtlvtdyvekmifimpgqadvlkgrqafrsaldnlgeilppgfeitglrq legeneivsivewksdkmiasqlsvlfkfegdqiyeerwfvdteqwksvf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.61 Rfree 0.181
    Matthews' coefficent 2.00 Rfactor 0.151
    Waters 151 Solvent Content 38.49

    Ligand Information



    Protein Summary

    Gene CPS_3947 from Colwellia psychrerythraea 34h encodes the YP_270605 protein that belongs to the SCOP alpha+beta class, NTF2-like superfamily, hypothetical protein egc068 family (PF12680).

    DALI top hits for 3lyg are with putative polyketide cyclases 3f7x and 3i0y (Z=15), or uncharacterized NTF2-like proteins 3ec9 and 3ebt (Z=14). 3lyg most similar structure in terms of primary sequence is 1tuh (seq id 21%; Z=14). There is an imidazole molecule and ordered waters in the active site which is relatively inaccessible to solvent.

    JCSG has solved many structures with similar fold, all belong to SnoaL. Almost all are dimeric.

    Fig 1. 3lyg monomer in complex with imidazole (sphere)


    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (1)

    FileSizeDateAttached by 
    115.28 kB22:40, 19 Feb 2010qxuActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch