.
The Open Protein Structure Annotation Network
PDB Keyword
.

3lyh

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Putative cobalamin (vitamin B12) biosynthesis CbiX protein (YP_958415.1) from Marinobacter aquaeolei VT8 at 1.60 A resolution. To be published
    Site JCSG
    PDB Id 3lyh Target Id 403199
    Molecular Characteristics
    Source Marinobacter aquaeolei vt8
    Alias Ids TPS30774,YP_958415.1, _0011.002880_, 322301 Molecular Weight 13916.20 Da.
    Residues 125 Isoelectric Point 5.35
    Sequence mtqphqiillahgssdarwcetfeklaeptvesienaaiaymelaepsldtivnrakgqgveqftvvpl flaagrhlrkdvpamierleaehgvtirlaepigknprlglairdvvkeelerseh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.60 Rfree 0.209
    Matthews' coefficent 1.85 Rfactor 0.170
    Waters 221 Solvent Content 33.34

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3lyh
    1. Structural and Kinetic Insights Reveal That the Amino Acid Pair Gln-228/Asn-254 Modulates the Transfructosylating Specificity of Schwanniomyces occidentalis _-
    M lvaro-Benito, MA Sainz-Polo - Journal of Biological , 2012 - ASBMB
     

    Protein Summary

    The structure forms a dimer through helix swapping. The monomer structure is very similar to 1tjn (21% seq id), which also forms a swapped dimer (via crystallographic symmetry). A similar dimer formed via gene duplication is also seen in 1qgo.

     

    The structure is a member of PFAM CbiX. Many members of this family are Co/Fe chelatases.

     

    Fig 1.  dimer (domain swapped)

    mh15805b.png

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (1)

    FileSizeDateAttached by 
     mh15805b.png
    MJ15805B dimer
    140.85 kB21:10, 4 Feb 2010qxuActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch