.
The Open Protein Structure Annotation Network
PDB Keyword
.

3mcs

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Putative monooxygenase (FN1347) from FUSOBACTERIUM NUCLEATUM SUBSP. NUCLEATUM ATCC 25586 at 2.55 A resolution. To be published
    Site JCSG
    PDB Id 3mcs Target Id 402910
    Molecular Characteristics
    Source Fusobacterium nucleatum subsp. nucleatum atcc 25586
    Alias Ids TPS30762,NP_604244.1, 3.30.70.900, 322411 Molecular Weight 25190.18 Da.
    Residues 218 Isoelectric Point 5.28
    Sequence myavpilnvydfevkkdketsyksatedyvnktmgveqgvlglfaatderdkttsyiveiyndylafsn htknqaskdfkavipqiaegnlnsaeidvqiakdkkieqndntfavytvidvkpendkefaeiiknive ttfneegtllvylgtdrrnfnkwclfevykdidsylnhrsakyfkdyitqtkdmiagkkraelqvlkie nkggldykkly
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.55 Rfree 0.261
    Matthews' coefficent 2.23 Rfactor 0.212
    Waters 41 Solvent Content 44.86

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    Gene FN1347 from Fusobacterium nucleatum subsp. nucleatum atcc 25586 encodes the NP_604244 protein that  belongs to the antibiotic biosynthesis monoxygenase (ABM) (PF03992). The amino acid sequence indicates and the structure confirms that this domain is duplicated in FN1347. This domain is believed to be involved in the biosynthesis of several antiobiotic without the assistance of prosthetic groups. Fusobacterium nucleatum is an anaerobic bacterium that has been implicated in the establishment of other species of dental pathogens. The structure of 3mcs was determined using Se-Met multiwavelength anomalous difffraction at a resolution of 2.55 Angstroms. Shown below is a ribbon representation of the structure with the N-terminal end in blue and the C-terminal end in red. The crystal structure indicates that the monomer is a significant oligomerization state.

     

    monomer.png

     

     

     

     

     

     

     

     

     

     

     

     

     

     

     

     

    A DALI search shows that 3mcs is similar to the following structures:

     

    PDB ID
    DALI Z-Score
    rmsd (Ang)
    length of alignment
    number of residues in similar structure
    % Sequence ID
    Description
    3f44 29.7 1.8  209  210 21  Putative monoxygenase (YP_193413.1) from Lactobacillus acidophilus NCFM at 1.55 Ang.
    3gn6 18.1 2.9  200  294 11  CT0912, ORFan protein from Chlorbium tepidum TLS with a ferredoxin-like domain repeat (NP_661805.1) at 1.8 Ang.
    2pgc 18.1 3.1  193  206 11  Uncharacterized protein (JCVI_PEP_1096685590403)  from a environmental metagenome (unidentified marine microbe) at 2.53 Ang.
    2cb2 17.9 3.3  210  307 10  Sulfur oxygenase reductase from Acidanus ambivalens
    3bxv 17.6 3.3  211  308  8  Sulfur oxygenase reductase from Acidanus tengchongensis
    3fez 13.5 3.3  156  169  9  Uncharacterized ferredoxin fold protein related to antibiotic biosynthesis monnoxygenases (YP_014836.1) from Listeria monocytogenes 4b F2365 at 2.10 Ang.
    3fj2 13.3 3.2  153  170  8 Monoxygenase-like protein (NP_471648.1) from Listeria innocua at 1.85 Ang
    3dtz 11.8 3.3  170  221  9  Putative chlorite dismutase TA0507
    3kkf 11.2 1.7  103  105  23  Putative antibiotic monoxygenase (NP_810307.1) from Bacteroides trhetaiotamicron VPI-5482 at 1.3 Ang
    2omo 10.9 1.5  98  99  16  Putative antibiotic biosynthesis monoxygenase from Nitrosomonas europaea

    Six of the top DALI hits are JCSG targets.

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (2)

    FileSizeDateAttached by 
     monomer.png
    No description
    185.78 kB01:26, 22 Feb 2010haxelrodActions
     N_term_C_term_overlap.png
    overlap of dulplicated domains
    996.16 kB16:55, 21 Apr 2010haxelrodActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch