.
The Open Protein Structure Annotation Network
PDB Keyword
.

3mcw

    Title Crystal structure of an a putative hydrolase of the isochorismatase family (CV_1320) from Chromobacterium violaceum ATCC 12472 at 1.06 A resolution. To be published
    Site JCSG
    PDB Id 3mcw Target Id 402579
    Molecular Characteristics
    Source Chromobacterium violaceum atcc 12472
    Alias Ids TPS30745,NP_900990.1, _0013.001003_, 325046 Molecular Weight 21109.69 Da.
    Residues 197 Isoelectric Point 5.64
    Sequence mpaplrfssdkpllllidmqqavddpswgprnhpqaeqacagllqawrarglplihirhdsvepnstyr pgqpghafkpeveprpgetviakqtnsafigtgleallrangwlelvvagvstsnsveatvrmagnlgf avclaedgcftfdktdwhgrrrsadevhamslanldgeycrvcgsadilaalgniagaa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.06 Rfree 0.151
    Matthews' coefficent 2.31 Rfactor 0.131
    Waters 543 Solvent Content 46.82

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3mcw
    1. Crystal structure of a putative isochorismatase hydrolase from Oleispira antarctica
    AM Goral, KL Tkaczuk, M Chruszcz, O Kagan - Journal of Structural and , 2012 - Springer
     

    Protein Summary

    The gene CV_1320 from Chromobacterium violaceum atcc 12472 encodes the NP_900990 protein that belongs to the group PF00857 Isochorismatase which is a family of hydrolase enzymes. Isochorismatase, also known as 2,3 dihydro-2,3 dihydroxybenzoate synthase catalyses the conversion of isochorismate, in the presence of water, to 2,3-dihydroxybenzoate and pyruvate.

    There are several structures available in this family.

    The monomer structure of 3MCW is shown below.

    MJ0968E.png

    The protein most likely assembles as a dimer.

    MJ0968E_dimer.png

     

    As mentioned above, there are several structurally similar proteins available in PDB. A DALI search confirms this:

    DALI Structural Homologs
    N PDB Z-score RMSD LALI NRES %ID TITLE 
    1 3irv 25.0 1.9 187 213 21 CYSTEINE HYDROLASE
    2 3kl2 24.7 1.9 177 203 25 PUTATIVE ISOCHORISMATASE
    3 1j2r 23.9 1.7 167 188 29 HYPOTHETICAL ISOCHORISMATASE FAMILY PROTEIN YECD
    4 3hu5 23.6 2.1 171 190 26 ISOCHORISMATASE FAMILY PROTEIN
    5 3hb7 23.4 1.9 171 179 25 ISOCHORISMATASE HYDROLASE
    6 2a67 23.3 1.9 165 167 24 ISOCHORISMATASE FAMILY PROTEIN
    7 1nba 22.8 1.9 174 253 22 N-CARBAMOYLSARCOSINE AMIDOHYDROLASE
    8 3eef 22.2 2.0 164 173 22 N-CARBAMOYLSARCOSINE AMIDASE RELATED PROTEIN
    9 1nf9 22.1 2.2 171 207 19 PHENAZINE BIOSYNTHESIS PROTEIN PHZD
    10 1nf8 22.1 2.3 171 207 19 PHENAZINE BIOSYNTHESIS PROTEIN PHZD

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch