The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of SusD superfamily protein (BT_2365) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.49 A resolution. To be Published
    Site JCSG
    PDB Id 3mcx Target Id 396190
    Molecular Characteristics
    Source Bacteroides thetaiotaomicron vpi-5482
    Alias Ids TPS25867,NP_811278.1, BIG_773, 326333 Molecular Weight 53255.51 Da.
    Residues 476 Isoelectric Point 4.91
    Sequence dwldlnttssvetgqaivtlddaqialngiyrlasghsyygdnywyygdcraadvqaritkgdgkrvsp yyeynvlasdnlnivlpwntvykvirqtnnliqkiesgsiqssdtkelnriksealvmrglslfnltrl fgmpytndkgaslgvpietspsdpthkpsrstvaqcyeqvvsdmsnalsglrqetsngyinywaaqall srvylnmgeyqkaydaatdviknnggryqlysyeeypnvwgqdfqseslfelyitlsepsggtggegap mvyaneatvdwnnlilsedflnllnedpkdvrhcltkesvienntglpaaamhekvylakfpgktgddp ktnniciirlsevylnaaeaglkkgtdieeaqgylndiisrrttdtsqqvstetftldrilkerrkelv gegevfydylrnglaierkgswhletlkasnaqkieatdlrialpipqseidanpniqqnpr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.49 Rfree 0.161
    Matthews' coefficent 2.70 Rfactor 0.142
    Waters 770 Solvent Content 54.51

    Ligand Information



    Protein Summary

    BT_2365 (NP_811278) from Bacteroides thetaiotaomicron vpi-5482 is a SusD homolog matching Pfam PF07980


    JCSG has solved structures of numerous SusD protein like 3mcx; for example PDB ids 3kez (~37%  seq id) and 3jq1, 3lew, 3ihv and 3l22 (all with ~22-26% sed id); and 3iv0, 3hdx, 3jq0, 3jys, 3fdh, 3ejn, 3cgh, 3gzs.


    Expression data from Jeff Gordon lab, shows that BT_2365 is strongly upregulated in the early phase (3-6h) of rich polysaccharide (in contrast to minimal media + glucose or maltose) diet both in vitro and in vivo (mouse cecum)



    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (2)

    FileSizeDateAttached by 
    No description
    451.39 kB00:35, 10 Feb 2010debanuActions
    No description
    12.83 kB15:55, 1 Jun 2010adamActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch