.
The Open Protein Structure Annotation Network
PDB Keyword
.

3mdo

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a Putative phosphoribosylformylglycinamidine cyclo-ligase (BDI_2101) from Parabacteroides distasonis ATCC 8503 at 1.91 A resolution. To be published
    Site JCSG
    PDB Id 3mdo Target Id 394435
    Molecular Characteristics
    Source Parabacteroides distasonis atcc 8503
    Alias Ids TPS26629,YP_001303454.1, _0066.001854_, 326808 Molecular Weight 42490.30 Da.
    Residues 388 Isoelectric Point 5.32
    Sequence msdqrynlrgvsaskedvhnaiknidkgifpkafckiipdilggdpeycnimhadgagtksslaymywk etgdlsvwkgiaqdalimniddllcvgavdnilvsstigrnkllvpgevisaiingtdellaelremgv gcyatggetadvgdlvrtiivdstvtcrmkrsdvidnkniqggdvivglassgqatyekeynggmgsng ltsarhdvfskylakkypesydaavpkelvysgglkltdkieelgidagkmvlsptrtyapvikvlldk lrsqihgmvhcsggaqtkvmhfvenkrvtkdnlfpipplfrtiqeqsgtdwsemykvfnmghrmeiyia pehaeevigisksfgidaqivgfveeadkneliiesekgrfty
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.91 Rfree 0.190
    Matthews' coefficent 2.36 Rfactor 0.154
    Waters 464 Solvent Content 47.78

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    Pfam update: AIRS_C family. The N-terminus is less well characterized. I would expect for the N-terminal to be AIRS like, but it is not significantly matching our current model.

    Gene BDI_2101 from Parabacteroides distasonis atcc 8503 encodes the YP_001303454 protein belonging to the C-terminal domain of the AIR synthase related proteins group (PF02769). Its GeneBank entry is annotated as a putative phosphoribosylformylglycinamidine cyclo-ligase.

    The 3mdo monomer structure is similar to that of other related proteins (for example, a JCSG solved structure with 68% sequence identity, PDB id 3KIZ):

    Fig1.png

    3mdo is present as a dimer in the crystal structure:

    Fig2.png

    Other related proteins can be found via the FFAS link above.

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (2)

    FileSizeDateAttached by 
     Fig1.png
    No description
    325.33 kB23:10, 25 Feb 2010debanuActions
     Fig2.png
    No description
    622.13 kB23:10, 25 Feb 2010debanuActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch