.
The Open Protein Structure Annotation Network
PDB Keyword
.

3msw

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a Protein with unknown function (BF3112) from Bacteroides fragilis NCTC 9343 at 1.90 A resolution. To be published
    Site JCSG
    PDB Id 3msw Target Id 386761
    Molecular Characteristics
    Source Bacteroides fragilis nctc 9343
    Alias Ids TPS33699,YP_212725.1, 327505 Molecular Weight 16954.12 Da.
    Residues 144 Isoelectric Point 7.65
    Sequence tnngkqfihndtmeggklvcreiyamndaasgilnpvkmykysydtdqqktvkstyawnifkntwetes rtvisryetetsveysvwnkekgsfdlskkyiyitdnnnqliaqyaykmnsrtnqwilekdaltpiyen iyattr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.2266
    Matthews' coefficent 2.48 Rfactor 0.1974
    Waters 128 Solvent Content 50.33

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    Single layer beta-sheet protein, similar to middle region of OspA.

     

    Fig 1. a first isolated SLP

    gs13265a.png

     

    Notes from PFam: The new family is PF12930 and you can get a preview of it at: https://pfamsvn.sanger.ac.uk/svn/pfa...ilies/PF12930/ It is a DUF, found in Bacteroidales.

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (1)

    FileSizeDateAttached by 
     gs13265a.png
    gs13265a monomer
    75.08 kB17:21, 2 Jun 2010qxuActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch