.
The Open Protein Structure Annotation Network
PDB Keyword
.

3mtq

    Title Crystal structure of a putative phosphoenolpyruvate-dependent sugar phosphotransferase system (PTS) permease (KPN_04802) from Klebsiella pneumoniae subsp. pneumoniae MGH 78578 at 1.70 A resolution. To be published
    Site JCSG
    PDB Id 3mtq Target Id 399660
    Molecular Characteristics
    Source Klebsiella pneumoniae subsp. pneumoniae mgh 78578
    Alias Ids TPS29754,YP_001338415.1, _0095.004261_, 326428 Molecular Weight 15635.99 Da.
    Residues 140 Isoelectric Point 4.73
    Sequence mkrhyifashgsfangllnsvelilgkqpdihtlcayveeevdltqqvealvarfpaqdelivitdifa gsvnnefvrflsrphfhllsglnlpliidllisaaednteklitealtnakesiqycnqtiasamtmdk df
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.70 Rfree 0.243
    Matthews' coefficent 1.97 Rfactor 0.205
    Waters 239 Solvent Content 37.63

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

     The protein YP_001338415.1 is annotated as putative PTS permease. YP_001338415.1 belongs to PFAM PF03610 EIIA-man.

    The phosphoenolpyruvate-dependent sugar phosphotransferase system (PTS) PUBMED:8246840, PUBMED:2197982 is a major carbohydrate transport system in bacteria. The PTS catalyses the phosphorylation of incoming sugar substrates and coupled with translocation across the cell membrane, makes the PTS a link between the uptake and metabolism of sugars.

    A cartoon representation of the monomer structure of the protein is shown below.

    MI15944AI.png

    The protein most likely dimerizes as shown below.

    MI15944AI_dimer.png

     

     

    There are several structural homologs:

    DALI Structural Homologs
    N PDB Z-score RMSD LALI NRES %ID Description
    1 2jzo 16.2 2.3 125 129 21 PTS SYSTEM MANNOSE-SPECIFIC EIIAB COMPONENT
    2 1vrc 16.2 2.3 124 128 21 PTS SYSTEM, MANNOSE-SPECIFIC IIAB COMPONENT
    3 1pdo 16.2 2.3 125 129 21 MANNOSE PERMEASE
    4 2jzn 16.1 2.4 129 133 20 MANNOSE-SPECIFIC PHOSPHOTRANSFERASE ENZYME IIA
    5 1vsq 16.0 2.3 127 133 21 MANNOSE-SPECIFIC PHOSPHOTRANSFERASE ENZYME IIA
    6 2iac 15.9 2.0 123 129 21 PTS SYSTEM, IIA COMPONENT
    7 3bed 15.8 2.1 125 132 19 PTS SYSTEM, IIA COMPONENT
    8 3ipr 15.3 2.6 129 140 20 PTS SYSTEM, IIA COMPONENT
    9 3gdw 12.5 3.2 128 138 13 SIGMA-54 INTERACTION DOMAIN PROTEIN
    10 3gx1 12.4 2.7 119 126 15 LIN1832 PROTEIN

     

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch