.
The Open Protein Structure Annotation Network
PDB Keyword
.

3mvu

    Title Crystal structure of a TenA family transcription regulator (TM1040_3656) from SILICIBACTER SP. TM1040 at 1.80 A resolution. To be published
    Site JCSG
    PDB Id 3mvu Target Id 394535
    Molecular Characteristics
    Source Silicibacter sp. tm1040
    Alias Ids TPS25326,YP_611885.1, _0077.002005_, 333001 Molecular Weight 24840.77 Da.
    Residues 225 Isoelectric Point 4.97
    Sequence msepygkafslmraeaepawraythhafveglkagtlpreaflhylqqdyvflihfsrawalavvkset hsemlaavgtvnalvaeemqlhigiceasgisqealfatreraenlaytrfvleagysgdlldllaala pcvmgygeigkrltaeatstlygdwidtyggddyqaackavgtllddalerrlgaeftssprwsrlcqt fhtatelevgfwqmgltp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.80 Rfree 0.179
    Matthews' coefficent 2.27 Rfactor 0.165
    Waters 111 Solvent Content 45.71

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    The protein YP_611885.1 is annotated as transcriptional activator, TenA family. YP_611885.1 belongs to PFAM PF03070 TENA_THI-4 .

     

    A rainbow representation of the protein is shown below.

    MH10810A.png

    The protein may assemble either as a tetramer according to the crystal packing and size exclusion/SLS determination.

     MH10810A_tetra.png

     

     

    There are numerous structural homologs of this protein, shown in the table below.

    DALI Structural Homologs
    N PDB Z-score RMSD LALI NRES %ID Description
    1 2rd3 29.2 1.7 211 218 27 TRANSCRIPTIONAL REGULATOR
    2 3ibx 28.9 1.8 211 216 27 PUTATIVE THIAMINASE II
    3 1yaf 28.6 1.7 211 218 26 TRANSCRIPTIONAL ACTIVATOR TENA
    4 1yak 28.4 1.7 211 219 26 TRANSCRIPTIONAL ACTIVATOR TENA
    5 2gm8 28.3 1.6 207 215 26 TENA HOMOLOG/THI-4 THIAMINASE
    6 2qcx 28.2 1.7 211 222 26 TRANSCRIPTIONAL ACTIVATOR TENA
    7 2gm7 28.1 1.6 207 212 26 TENA HOMOLOG/THI-4 THIAMINASE
    8 1tyh 28.1 1.8 211 221 27 TRANSCRIPTIONAL ACTIVATOR TENA
    9 1to9 28.1 1.7 211 223 27 THI-4 PROTEIN
    10 1udd 27.7 1.7 207 213 26 TRANSCRIPTIONAL REGULATOR

    A superposition of these structures is shown below.

    MH10810A_all.png

    YP_611885.1 (green), 1to9 (cyan), 1tyh (lightmagenta), 1udd (yellow), 1yaf (salmon), 1yak (lightgrey), 2gm7 (slate), 2gm8 (orange), 2qcx (lime), 2rd3 (deepteal), 3ibx (hotpink)

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch