.
The Open Protein Structure Annotation Network
PDB Keyword
.

3mw8

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of an UROPORPHYRINOGEN-III SYNTHASE (Sama_3255) from SHEWANELLA AMAZONENSIS SB2B at 1.65 A resolution. To be published
    Site JCSG
    PDB Id 3mw8 Target Id 398935
    Molecular Characteristics
    Source Shewanella amazonensis sb2b
    Alias Ids TPS30574,YP_929127.1, _0039.001102_, _0057.000943_, 327791 Molecular Weight 25482.76 Da.
    Residues 239 Isoelectric Point 5.54
    Sequence mkllltrpegknaamasaldalaipylvepllsveaaavtqaqldelsradilifistsavsfatpwlk dqwpkatyyavgdatadalalqgitaerspadsqateglltlpsleqvsgkqivivrgkggreamadgl rlrganvsylevyqracppldapasvsrwqsfgidtivvtsgevlenlinlvpkdsfawlrdchiivps arvetqarkkglrrvtnagaanqaavldalgm
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.65 Rfree 0.203
    Matthews' coefficent 2.91 Rfactor 0.175
    Waters 231 Solvent Content 57.74

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    This is a bacterial homologue of Uroporphyrinogen III synthase (U3S, 20% seq id, pdb 1jr2). There are a few other bacterial homolog structures in database (1wcx, 1wcw, 3d8n etc), but the sequence similarity level is low.

     

    This protein is now in PFAM family HEM4 PF02602.

    Figure 1. Structure comparison with human U3S (green).

    vs1jr2.png

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (1)

    FileSizeDateAttached by 
     vs1jr2.png
    MI15755X vs 1jr2
    167.83 kB18:30, 29 Mar 2010qxuActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch