.
The Open Protein Structure Annotation Network
PDB Keyword
.

3mx3

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a SusD homolog (BF0972) from Bacteroides fragilis NCTC 9343 at 2.00 A resolution. To be published
    Site JCSG
    PDB Id 3mx3 Target Id 419558
    Molecular Characteristics
    Source Bacteroides fragilis nctc 9343
    Alias Ids TPS33869,YP_210662.1 Molecular Weight 55348.31 Da.
    Residues 489 Isoelectric Point 4.98
    Sequence ascdkfdeintdpdattkvtssllatglllditsssasksfiydellakqmawgesmedyqynvfgrsg fggyttlinaqkmvesvsddnvnaydglahfikaykifymsmemgdlpyeealqgelglvrpkyntqke vmnfilsdletayelfstakdfdgdpilggsiskwkkattafqlkvlmhlskkesdadlkvkerfariv asgslmesnednlqmkyadkantvypfhntntkhagyamlstmlidkfkatgdirmfyyakpakaklne gvtadswdayigtdpslpfeqiekayateqysgfnarytdypsgepvvrlgyaeqnfilaeaavrgwis gdasayykkairahmefiasntpdeevyhhghpiteeaiaafletpaiqlsgekeadiekiltqrylas fmqhpydvyydyrrtgypvlpinpatnrntmndrlpmrwmypksesdynlehqnealerqfggvddvnklmwilq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.216
    Matthews' coefficent 2.09 Rfactor 0.164
    Waters 912 Solvent Content 41.09

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3mx3
    1. Glycan recognition by the Bacteroidetes Sus-like systems
    DN Bolam, NM Koropatkin - Current Opinion in Structural Biology, 2012 - Elsevier
     
    2. Blind prediction of quaternary structures of homo-oligomeric proteins from amino acid sequences based on templates
    M Morita, M Kakuta, K Shimizu, S Nakamura - 2012 - hoajonline.com
     

    Protein Summary

    A member of SusD family in complex with HEPES.

     

    Fig 1. 419558 in complex with HEPES

    gs8707g.png

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (1)

    FileSizeDateAttached by 
     gs8707g.png
    GS7807G with hepes
    193.12 kB17:12, 2 Jun 2010qxuActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch