.
The Open Protein Structure Annotation Network
PDB Keyword
.

3myv

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a SusD superfamily protein (BVU_0732) from Bacteroides vulgatus ATCC 8482 at 1.80 A resolution. To be published
    Site JCSG
    PDB Id 3myv Target Id 396549
    Molecular Characteristics
    Source Bacteroides vulgatus atcc 8482
    Alias Ids TPS26682,YP_001298060.1, BIG_773, 326086 Molecular Weight 50874.56 Da.
    Residues 453 Isoelectric Point 4.91
    Sequence nkipttmafrtvtdvdnavnglydlmsgsgyygaamfaygdmkgddmqsseesgvcntcymfnhrpnsl nagslwgrpfyilreawnilnaiaegkiesgdekklnalkgetmavialcqfdltrcfgypytkdkgas lgaplidhlvgtyenpprstvaqaydfiietleeavtlmseeknngrmnkyaarallariylyhddnrk afdladqlikdadtsgsyalyphekyvaawsveakfgsesffeiansvddtpgrdswgyllnwygyqkg fvtqkyaeqmladpgdvrghlleenkyagktvwwlyklrgtdlktaplecnnvvlrlsevyliaaeagc klggdaavqglgylneivkrgnpdnevtmadytldrvlderskelvgeghrffdllrngktivrkggyh lpsvdeevdwdfykcvlpipedqfifspemeqnpgypkn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.80 Rfree 0.190
    Matthews' coefficent 2.50 Rfactor 0.151
    Waters 1235 Solvent Content 50.74

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    Another SusD homolog (PF07980), very similar in structure and sequence to a previous jcsg structure (396190), rmsd 1.6, seq id 37%, and 3kez.

     

    Fig 1. Monomer

    px9961k.png

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (1)

    FileSizeDateAttached by 
     px9961k.png
    monomer of px9961k
    181.54 kB21:15, 18 Feb 2010qxuActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch