The Open Protein Structure Annotation Network
PDB Keyword


    Title Crystal structure of a Glycerophosphoryl diester phosphodiesterase (BDI_3922) from Parabacteroides distasonis ATCC 8503 at 1.55 A resolution. To be published
    Site JCSG
    PDB Id 3mz2 Target Id 396626
    Molecular Characteristics
    Source Parabacteroides distasonis atcc 8503
    Alias Ids TPS27958,YP_001305224.1, 327071 Molecular Weight 33171.70 Da.
    Residues 291 Isoelectric Point 4.81
    Sequence eeleykgmntlqisnvddlisfyqyaddriplisghrggrgkgypensmetfentlsytpatfeidprl tkdsvivlfhddtlertsngtgkvsdytweelqnfrlkdpegnitnyriptleeairwargktilildk kdvpmertaqlitdmqaepyvmitvhdgasarffyeknpnfmfeafvktkeavqdyedngipwshimay vgpkitpevrevidmlhergvmcmistapsddklstpesraeayrmiirqgvdiiesdrpievaeaiss lipvssskgkffstl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.55 Rfree 0.197
    Matthews' coefficent 2.01 Rfactor 0.166
    Waters 541 Solvent Content 38.77

    Ligand Information



    Protein Summary

    The protein YP_001305224.1 is annotated as Glycerophosphoryl diester phosphodiesterase. YP_001305224.1 belongs to PFAM PF03009 GDPD. 

    The monomer structure is a barrel flanked by helices, shown below.



    Theer are several structural homologs of this protein, shown below in the table.

    DALI Structural Homologs
    N PDB Z-score RMSD LALI NRES %ID TITLE (JCSG structures highlighted in red)
    1 3i10 26.0 2.5 256 278 24 PUTATIVE GLYCEROPHOSPHORYL DIESTER
    5 3l12 21.7 2.8 240 295 20 PUTATIVE GLYCEROPHOSPHORYL DIESTER


    The superposition of this protein (green) with 3i10 (orange) is shown below.


    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (2)

    FileSizeDateAttached by 
    No description
    110.21 kB19:05, 4 Mar 2010abhinavkActions
    No description
    161.29 kB19:05, 4 Mar 2010abhinavkActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch