.
The Open Protein Structure Annotation Network
PDB Keyword
.

3no2

    Table of contents
        1. 1.1.1. Protein Summary
    1. 2. Summary
        1. 2.1.1.
        2. 2.1.2. Ligand Summary

    Title Crystal structure of a protein of unknown function (BACCAC_01654) from Bacteroides caccae at 1.35 A resolution. To be published
    Site JCSG
    PDB Id 3no2 Target Id 416597
    Molecular Characteristics
    Source Bacteroides caccae atcc 43185
    Alias Ids TPS33795,ZP_01960044.1, 327443 Molecular Weight 30395.19 Da.
    Residues 275 Isoelectric Point 6.60
    Sequence sspqhllvggsgwnkiaiinkdtkeivweyplekgwecnsvaatkageilfsyskgakmitrdgrelwn iaapagcemqtarilpdgnalvawcghpstilevnmkgevlsktefetgierphaqfrqinknkkgnyl vplfatsevreiapngqllnsvklsgtpfssafldngdclvacgdahcfvqlnlesnrivrrvnandie gvqlffvaqlfplqngglyicnwqghdreagkgkhpqlveidsegkvvwqlndkvkfgmisticpire
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.35 Rfree 0.1595
    Matthews' coefficent 2.54 Rfactor 0.1468
    Waters 369 Solvent Content 51.48

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3no2
    1. Blind prediction of quaternary structures of homo-oligomeric proteins from amino acid sequences based on templates
    M Morita, M Kakuta, K Shimizu, S Nakamura - 2012 - hoajonline.com
     

    Protein Summary

     

    The 416597 from Bacteroides caccae encodes the protein with unknown function. The protein structure adopts bladed beta propeller folds belonging to the Ca-dependent phosphotriesterase superfamily. A DALI structural similarity search provides the top hit with the Nidogen beta-propeller protein 1npe (Z=24). Superposition of two structures are shown below. Blue is 416597, and grey is 1npe.

    super_1npe.png

     

    Similar structures determined by PSI centers include 2p4o, 3hrp, 3e5z and 2ghs.

    DALI summary is:

    Summary

        No:  Chain   Z    rmsd lali nres  %id PDB  Description
    1: 1npe-A 23.8 3.0 243 263 12 PDB MOLECULE: NIDOGEN; 2: 1n7d-A 21.4 3.1 240 639 10 PDB MOLECULE: LOW-DENSITY LIPOPROTEIN RECEPTOR; 3: 1ijq-A 21.3 3.0 237 308 11 PDB MOLECULE: LOW-DENSITY LIPOPROTEIN RECEPTOR; 4: 3g4e-B 21.0 2.9 235 297 11 PDB MOLECULE: REGUCALCIN; 5: 3g4h-A 21.0 2.8 235 297 11 PDB MOLECULE: REGUCALCIN; 6: 1ijq-B 21.0 3.0 234 305 10 PDB MOLECULE: LOW-DENSITY LIPOPROTEIN RECEPTOR; 7: 3g4e-A 20.9 2.8 235 297 11 PDB MOLECULE: REGUCALCIN; 8: 3ets-A 20.8 3.4 261 562 14 PDB MOLECULE: ARYLSULFATE SULFOTRANSFERASE; 9: 3ets-B 20.8 3.4 261 564 14 PDB MOLECULE: ARYLSULFATE SULFOTRANSFERASE; 10: 3elq-A 20.7 3.4 261 563 14 PDB MOLECULE: ARYLSULFATE SULFOTRANSFERASE; 11: 3ett-A 20.6 3.4 260 564 14 PDB MOLECULE: ARYLSULFATE SULFOTRANSFERASE; 12: 3ett-B 20.6 3.4 261 565 14 PDB MOLECULE: ARYLSULFATE SULFOTRANSFERASE; 13: 3g4h-B 20.6 2.8 234 297 11 PDB MOLECULE: REGUCALCIN; 14: 3elq-B 20.5 3.4 261 566 14 PDB MOLECULE: ARYLSULFATE SULFOTRANSFERASE; 15: 2p4o-A 20.4 2.9 227 302 10 PDB MOLECULE: HYPOTHETICAL PROTEIN; 16: 3fw0-A 20.4 3.0 237 329 15 PDB MOLECULE: PEPTIDYL-GLYCINE ALPHA-AMIDATING MONOOXYGENASE; 17: 3fvz-A 20.3 3.1 237 329 15 PDB MOLECULE: PEPTIDYL-GLYCINE ALPHA-AMIDATING MONOOXYGENASE; 18: 1q7f-B 20.1 3.1 223 282 14 PDB MOLECULE: BRAIN TUMOR CG10719-PA; 19: 2ism-A 19.9 2.6 228 327 15 PDB MOLECULE: PUTATIVE OXIDOREDUCTASE; 20: 3das-A 19.8 2.7 231 334 13 PDB MOLECULE: PUTATIVE OXIDOREDUCTASE; 21: 2ism-B 19.7 2.6 228 333 15 PDB MOLECULE: PUTATIVE OXIDOREDUCTASE; 22: 1l0q-D 19.6 3.5 234 391 13 PDB MOLECULE: SURFACE LAYER PROTEIN; 23: 1l0q-C 19.6 3.5 234 391 13 PDB MOLECULE: SURFACE LAYER PROTEIN; 24: 1q7f-A 19.5 3.4 223 279 14 PDB MOLECULE: BRAIN TUMOR CG10719-PA; 25: 3hrp-A 19.4 3.2 235 400 9 PDB MOLECULE: UNCHARACTERIZED PROTEIN; 26: 1l0q-A 19.3 3.6 234 391 13 PDB MOLECULE: SURFACE LAYER PROTEIN; 27: 1l0q-B 19.3 3.5 234 391 13 PDB MOLECULE: SURFACE LAYER PROTEIN; 28: 1rwl-A 19.2 3.1 218 254 11 PDB MOLECULE: SERINE/THREONINE-PROTEIN KINASE PKND; 29: 3e5z-B 19.1 3.1 222 290 13 PDB MOLECULE: PUTATIVE GLUCONOLACTONASE; 30: 2ghs-A 19.0 3.0 231 294 13 PDB MOLECULE: AGR_C_1268P; 31: 3e5z-A 19.0 3.1 221 290 13 PDB MOLECULE: PUTATIVE GLUCONOLACTONASE; 32: 1h6l-A 19.0 2.9 229 353 12 PDB MOLECULE: PHYTASE; 33: 1cvm-A 18.9 2.9 229 353 12 PDB MOLECULE: PHYTASE; 34: 3dr2-B 18.9 3.0 221 297 12 PDB MOLECULE: EXPORTED GLUCONOLACTONASE; 35: 1rwi-A 18.9 3.1 217 256 12 PDB MOLECULE: SERINE/THREONINE-PROTEIN KINASE PKND; 36: 3dr2-A 18.8 3.1 221 299 12 PDB MOLECULE: EXPORTED GLUCONOLACTONASE; 37: 1qlg-A 18.8 2.9 230 353 13 PDB MOLECULE: 3-PHYTASE; 38: 1poo-A 18.8 2.9 229 353 12 PDB MOLECULE: PROTEIN (PHYTASE); 39: 2poo-A 18.8 2.9 230 353 13 PDB MOLECULE: PROTEIN (PHYTASE); 40: 3iax-A 18.8 3.3 234 399 9 PDB MOLECULE: PROTEIN TOLB; 41: 2ivz-D 18.8 3.2 233 387 9 PDB MOLECULE: PROTEIN TOLB; 42: 1rwi-B 18.8 3.1 217 254 12 PDB MOLECULE: SERINE/THREONINE-PROTEIN KINASE PKND; 43: 1crz-A 18.8 3.2 234 403 8 PDB MOLECULE: TOLB PROTEIN; 44: 3bws-B 18.7 3.4 239 407 9 PDB MOLECULE: PROTEIN LP49; 45: 2dso-B 18.7 3.4 231 321 12 PDB MOLECULE: DRP35; 46: 2dso-D 18.7 3.4 231 321 12 PDB MOLECULE: DRP35; 47: 2dso-A 18.7 3.4 231 322 12 PDB MOLECULE: DRP35; 48: 2dso-E 18.7 3.4 231 321 12 PDB MOLECULE: DRP35; 49: 2dso-F 18.7 3.4 231 320 12 PDB MOLECULE: DRP35; 50: 2hqs-F 18.7 3.2 234 410 9 PDB MOLECULE: PROTEIN TOLB;


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (2)

    FileSizeDateAttached by 
     SPmonomer.png
    No description
    182.33 kB00:29, 21 Jun 2010gyewonActions
     super_1npe.png
    No description
    311.92 kB00:29, 21 Jun 2010gyewonActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch