.
The Open Protein Structure Annotation Network
PDB Keyword
.

3npf

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a putative dipeptidyl-peptidase VI (BACOVA_00612) from Bacteroides ovatus at 1.72 A resolution. To be published
    Site JCSG
    PDB Id 3npf Target Id 416771
    Molecular Characteristics
    Source Bacteroides ovatus atcc 8483
    Alias Ids TPS33840,ZP_02063661.1, PF00877, 327375 Molecular Weight 34528.34 Da.
    Residues 305 Isoelectric Point 6.83
    Sequence qeirpmpadsaygvvhisvcnlreegkftsgmstqallgmpvkvlqyngwyeiqtpddytgwvhrmvit pmskerydewnraekivvtshygfayekpdessqpvsdvvagnrlkwegskghfyqvsypdgrkaylsk sisqpeagwraslkqdvesiietaysmmgipylwagtsskgvdcsglvrtvlfmhdiiiprdasqqayv gehidiapdfsnvkrgdlvffgrkataerkegishvgiylgnkqfihalgdvhvssmnpadqnydefnt krllfavrflpyinkekgmnttnknpfyq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.72 Rfree 0.1712
    Matthews' coefficent 2.10 Rfactor 0.1410
    Waters 798 Solvent Content 41.30

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3npf
    1. Assessment of ligand_binding residue predictions in CASP9
    T Schmidt, J Haas, TG Cassarino - Structure, Function, and , 2011 - Wiley Online Library
     
    2. Blind prediction of quaternary structures of homo-oligomeric proteins from amino acid sequences based on templates
    M Morita, M Kakuta, K Shimizu, S Nakamura - 2012 - hoajonline.com
     

    Protein Summary

     This structure is a homolog of 3h41, a NlpC/P60 cysteine peptidase.

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch