.
The Open Protein Structure Annotation Network
PDB Keyword
.

3nqi

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a Putative lipoprotein (BF3042) from Bacteroides fragilis NCTC 9343 at 1.87 A resolution. To be published
    Site JCSG
    PDB Id 3nqi Target Id 393248
    Molecular Characteristics
    Source Bacteroides fragilis nctc 9343
    Alias Ids TPS26595,YP_212656.1, 332452 Molecular Weight 26978.93 Da.
    Residues 245 Isoelectric Point 4.88
    Sequence mdsgesgpqqwagvvkvndrmgyvtftdaagteliptntipvtlnarmayiycqvdegqdlstnpksik itlladptgidataittpkvgesgdvttnapvgslsfvsgystvapfqfsentivlpvlyrvknvttte diknelakhtftlvcytddiksgdtilklylrykvedepaaiaeratrtssfkayeisqilreytlksg qtkpakitivaqqneynnkledtstiekvyeieyktae
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.87 Rfree 0.220
    Matthews' coefficent 2.64 Rfactor 0.191
    Waters 367 Solvent Content 53.46

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    The structure is similar to two other jcsg structures (3k0y and 3k6o) despite low sequence similarity (12%), belongs to a new Pfam family called NigD (PF12667). Maybe involved in immunity, bacteriocins.

     

    Figure 1. comparison with 3k0y (cyan)

    gs13779a-vs3k0y.png

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (1)

    FileSizeDateAttached by 
     gs13779a-vs3k0y.png
    gs13779a vs 3k0y
    126.73 kB21:07, 20 Nov 2009qxuActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch