.
The Open Protein Structure Annotation Network
PDB Keyword
.

3nqp

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a SusD superfamily protein (BF1802) from Bacteroides fragilis NCTC 9343 at 1.90 A resolution. To be published
    Site JCSG
    PDB Id 3nqp Target Id 396584
    Molecular Characteristics
    Source Bacteroides fragilis nctc 9343
    Alias Ids TPS25943,YP_211438.1, BIG_773, 326318 Molecular Weight 58034.15 Da.
    Residues 513 Isoelectric Point 5.40
    Sequence dkldlspidyygsgsywkteaqatayidgihkhlrdaawqhtitfgelrggrfitgassdgmgvsngdi ilqnfdethtgvskfgdlfgritnlnlfiarvtdatylsdemknfylgevyglrafyyfdlyriyggvp lrltadvvegvidpnklymarstpkevmtqiksdlnksmeyfgnmndfdpykrgkkvywskaateclmg evylwtskvttgddvanpadltiakthlesvlnnynlkmlddfsqvfnaknkandeiifairflegeat nsngtftynvgtgstknryqangevfgdaldiqntgnqtyeynkavyqnfddadtrkeatfiasynkdg ktgelslygthvrknigyvnaqgarvycgdyifyrlpwvyltlaeianmegdnaavakyinlvrkrayg nawdetlyaypetadfttnelailhekdkefiqegqrwwdlrrmtltkggtplvfckegsllgdapiln ksteahkllwpiektmlnkdpaleqtpgyk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.90 Rfree 0.19385
    Matthews' coefficent 2.58 Rfactor 0.15041
    Waters 1263 Solvent Content 52.41

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    The protein YP_211438.1 from  Bacteroides fragilis nctc 9343 annotated as a possible outer membrane protein. Pfam update: This protein is now in SusD, PF07980, with other structures.]

    There are two molecules found in the asu. However, anSEC supports a monomer as biological molecule. Ribbon diagram of the monomer is shown below.

     

    PXmonomer.png

    DALI summary

        No:  Chain   Z    rmsd lali nres  %id PDB  Description
    1: 3jq0-A 44.8 1.7 441 478 33 PDB MOLECULE: SUSD SUPERFAMILY PROTEIN; 2: 3kez-A 33.7 2.5 389 447 27 PDB MOLECULE: PUTATIVE SUGAR BINDING PROTEIN; 3: 3kez-B 33.6 2.5 389 448 27 PDB MOLECULE: PUTATIVE SUGAR BINDING PROTEIN; 4: 3l22-A 33.3 2.6 381 429 21 PDB MOLECULE: SUSD SUPERFAMILY PROTEIN; 5: 3iv0-A 33.2 3.0 416 466 19 PDB MOLECULE: SUSD HOMOLOG; 6: 3jq1-A 32.9 2.9 406 462 20 PDB MOLECULE: SUSD SUPERFAMILY PROTEIN; 7: 3jq1-B 32.7 2.9 407 464 20 PDB MOLECULE: SUSD SUPERFAMILY PROTEIN; 8: 3hdx-A 32.6 2.6 396 456 19 PDB MOLECULE: SUSD SUPERFAMILY PROTEIN; 9: 3jys-A 32.3 2.7 412 479 20 PDB MOLECULE: SUSD SUPERFAMILY PROTEIN; 10: 3ckc-B 31.2 2.4 398 500 21 PDB MOLECULE: SUSD; 11: 3ckc-A 31.1 2.4 398 501 21 PDB MOLECULE: SUSD; 12: 3ckb-B 31.1 2.4 398 501 21 PDB MOLECULE: SUSD; 13: 3ck7-A 31.1 2.5 398 496 21 PDB MOLECULE: SUSD; 14: 3ck8-A 31.0 2.5 401 501 21 PDB MOLECULE: SUSD; 15: 3ck8-B 31.0 2.5 401 501 21 PDB MOLECULE: SUSD; 16: 3ck7-C 31.0 2.5 398 497 21 PDB MOLECULE: SUSD; 17: 3ck7-B 31.0 2.5 398 497 21 PDB MOLECULE: SUSD; 18: 3ckb-A 30.9 2.4 398 504 21 PDB MOLECULE: SUSD; 19: 3ck7-D 30.9 2.6 400 498 21 PDB MOLECULE: SUSD; 20: 3ck9-A 30.7 2.5 402 508 21 PDB MOLECULE: SUSD; 21: 3ihv-A 30.3 3.0 434 535 19 PDB MOLECULE: SUSD HOMOLOG; 22: 3ck9-B 30.3 2.5 401 515 21 PDB MOLECULE: SUSD; 23: 3ihv-B 30.2 3.1 435 535 19 PDB MOLECULE: SUSD HOMOLOG; 24: 3lew-A 29.1 3.1 394 476 16 PDB MOLECULE: SUSD-LIKE CARBOHYDRATE BINDING PROTEIN; 25: 3i4g-A 28.0 2.7 392 513 18 PDB MOLECULE: SUSD-LIKE CARBOHYDRATE BINDING PROTEIN BF1063; 26: 3fdh-A 21.4 3.5 366 472 9 PDB MOLECULE: SUSD HOMOLOG; 27: 3ejn-A 20.5 3.4 346 450 12 PDB MOLECULE: SUSD HOMOLOG; 28: 3cgh-A 19.6 3.3 373 507 12 PDB MOLECULE: SUSD HOMOLOG; 29: 3gzs-B 18.9 3.4 356 495 12 PDB MOLECULE: UNCHARACTERIZED SUSD SUPERFAMILY PROTEIN; 30: 3ehn-A 18.8 3.5 369 514 12 PDB MOLECULE: SUSD HOMOLOG;

     

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (1)

    FileSizeDateAttached by 
     PXmonomer.png
    No description
    297.07 kB01:38, 13 Apr 2010gyewonActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch