.
The Open Protein Structure Annotation Network
PDB Keyword
.

3nuf

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a PRD-containing transcription regulator (LSEI_2718) from Lactobacillus casei ATCC 334 at 1.38 A resolution. To be published
    Site JCSG
    PDB Id 3nuf Target Id 392607
    Molecular Characteristics
    Source Lactobacillus casei atcc 334
    Alias Ids TPS27761,YP_807875.1, 325825 Molecular Weight 12893.04 Da.
    Residues 118 Isoelectric Point 4.66
    Sequence mtpldanvelptevkamieqssdaqaatalvnyviklaaaaeihftdlqlqvltnhliemlgrsksgeq lpavdptmfaevsqksldladqvvqhighlevaekyvlsihfeaaqdki
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.38 Rfree 0.192
    Matthews' coefficent 2.14 Rfactor 0.171
    Waters 325 Solvent Content 42.47

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3nuf
    1. Predicting protein structures with a multiplayer online game
    S Cooper, F Khatib, A Treuille, J Barbero, J Lee - Nature, 2010 - nature.com
     

    Protein Summary

    Pfam: This is a member of our PRD family. There are already four structures known for this family.

    YP_807875.1 from Lactobacillus casei atcc 334 encodes all alpha helical protein that belongs to the Pfam; PF00874; PRD family. There are two structures (1tlv and 1h99) known in this family. The crystal structure contains a dimer in asu. PISA suggests this is a biological unit.

    monomer.png

    Figure 1. Monomer of YP_807875.1

    Superposition of YP_807875.1 with 1h99 shows that N-terminal ( PRD1 domain) of 1h99 is very similar to YP_807875.1, however, YP_807875.1 structure misses C-terminal (PRD2 domain) of 1h99 as shown below.

    super_1h99.png

    Figure 2. Superposition of YP_807875.1 (blue) with 1h99 (purple). Please notice that C-terminal PRD2 domain of 1h99 is missing in the YP_807875.1 structure.

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (2)

    FileSizeDateAttached by 
     monomer.png
    No description
    144.47 kB03:12, 26 Mar 2010gyewonActions
     super_1h99.png
    No description
    210.74 kB03:12, 26 Mar 2010gyewonActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch