.
The Open Protein Structure Annotation Network
PDB Keyword
.

3o0f

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a metal-dependent phosphoesterase (YP_910028.1) from Bifidobacterium adolescentis: Computational prediction and experimental validation of phosphoesterase activity. Proteins 79 2146-2160 2011
    Site JCSG
    PDB Id 3o0f Target Id 387987
    Related PDB Ids 3e0f 
    Molecular Characteristics
    Source Bifidobacterium adolescentis atcc 15703
    Alias Ids TPS17937,YP_910028.1, 87495 Molecular Weight 32528.45 Da.
    Residues 300 Isoelectric Point 5.19
    Sequence mshvsyaeppaqgwdihchtvfsdgtetprtlveqarklglhgvaiadhdttagwdeateaseeiglpl llgteitavdedvsvhmlafqydpsnehissmfantraarlrrtkrmverlsqdfpitwddvlaqvkeg erttigrphiadalvaagvyetrsdafadavsakskyyiptpspstheviaavkgaggvvvaahagdpq rnrrllsdeqldamiadgldglevwhrgnppeqrerlltiaarhdllvtggsdwhgkgkpnglgenltd ddtvreilcrgvdligrvgsshaa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.94 Rfree 0.1916
    Matthews' coefficent 2.57 Rfactor 0.1597
    Waters 183 Solvent Content 52.10

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3o0f
    1. Crystal structure of a metal_dependent phosphoesterase (YP_910028. 1) from Bifidobacterium adolescentis: Computational prediction and experimental validation of
    GW Han, J Ko, CL Farr, MC Deller, Q Xu - Proteins: Structure, , 2011 - Wiley Online Library
     

    Protein Summary

     The BAD_1165 gene from Bifidobacterium adolescentis atcc15703 encodes a putative metal-dependent phosphatase (PF02811, COG0613, EC 3.1.3.-) that adopts a 7-stranded beta/alpha barrel fold and shows strong structural similarity to other structures from this family solved by structural genomics (PDB id: 2ANU [Z=15], 1M65 [Z=12]). Other DALI top hits for 3e0f are with 3e38 (Z=18), 3f2b (Z=17) and 2hpi (Z=16). For more details on the biology and mechanism of this enzyme, see relevant publication [Ref].

     

    To do: check existence of trinuclear metal-binding site - could Fe sites be replaced by zinc?

    Ligand Summary

    Reviews

    References

     

    1. (No Results)

       


      Discuss this publication
    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch