.
The Open Protein Structure Annotation Network
PDB Keyword
.

3obe

    Title Crystal structure of a sugar phosphate isomerase/epimerase (BDI_3400) from Parabacteroides distasonis ATCC 8503 at 1.70 A resolution. To be published
    Site JCSG
    PDB Id 3obe Target Id 396643
    Molecular Characteristics
    Source Parabacteroides distasonis atcc 8503
    Alias Ids TPS27982,YP_001304724.1, 327015 Molecular Weight 34543.45 Da.
    Residues 304 Isoelectric Point 6.04
    Sequence snptrsipatdavssatagkkmglqtyslgqellqdmpnglnrlakagytdleifgyredtgkfgdynp knttfiaskdykkmvddaglrissshltpslreytkenmpkfdefwkkatdihaelgvscmvqpslpri eneddakvvseifnrageitkkagilwgyhnhsnefkrvlkagekpeqnpnpwappkgtyieelflknt dpdkvmfeldvywavmgqqdpvewmenypnrfkllhikdrwiigdsgmmnfpnifkkayeigilgyyve legdkkgrtqfegveksaaylqaapfvk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.70 Rfree 0.1637
    Matthews' coefficent 2.26 Rfactor 0.1398
    Waters 575 Solvent Content 45.58

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    The protein YP_001304724.1 is annotated as Sugar phosphate isomerase/epimerase. YP_001304724.1 belongs to PFAM PF01261 AP_endonuc_2. This consists of TIM alpha/beta barrel structures found in xylose isomerase (P19148) and in endonuclease IV (P12638 EC:3.1.21.2). This domain is also found in the N termini of bacterial myo-inositol catabolism proteins. These are involved in the myo-inositol catabolism pathway, and is required for growth on myo-inositol in Rhizobium leguminosarum bv. viciae [1].

    There are over 200 structures in PFAM PF01261 family.

    The monomer structure is displayed below.

    PX9615D.png

     

    The structure is very similar to another JCSG structure 3l23, again a Sugar Phosphate Isomerase/epimerase from Parabacteroides Distasonis ATCC 8503. These two proteins have 51.5% sequence identity and superpose with 1.25A rmsd over 260 out of 282 residues. The superposition of these two structures is shown below.

    PX9615D_3l23.png

    YP_001304724.1 (green), 3l23 (magenta)

     

    Literature references
    1. Fry J, Wood M, Poole PS; , Mol Plant Microbe Interact 2001;14:1016-1025.: Investigation of myo-inositol catabolism in Rhizobium leguminosarum bv. viciae and its effect on nodulation competitiveness. PUBMED:11497462

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (2)

    FileSizeDateAttached by 
     PX9615D.png
    No description
    124.04 kB15:41, 2 Aug 2010abhinavkActions
     PX9615D_3l23.png
    No description
    220.76 kB15:45, 3 Aug 2010abhinavkActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch