.
The Open Protein Structure Annotation Network
PDB Keyword
.

3obi

    Title Crystal structure of a formyltetrahydrofolate deformylase (NP_949368) from RHODOPSEUDOMONAS PALUSTRIS CGA009 at 1.95 A resolution. To be published
    Site JCSG
    PDB Id 3obi Target Id 403519
    Molecular Characteristics
    Source Rhodopseudomonas palustris cga009
    Alias Ids TPS30781,NP_949368.1, _0004.004077_, 325337 Molecular Weight 32563.55 Da.
    Residues 287 Isoelectric Point 8.76
    Sequence mphhqyvltlscpdragivsavstflfengqnildaqqyndtesghffmrvvfnaaakviplaslrtgf gviaakftmgwhmrdretrrkvmllvsqsdhcladilyrwrvgdlhmiptaivsnhpretfsgfdfgdi pfyhfpvnkdtrrqqeaaitaliaqthtdlvvlarymqilsdemsarlagrcinihhsflpgfkgakpy hqafdrgvkligatahyvtsaldegpiidqdverishrdtpadlvrkgrdierrvlsralhyhlddrvi lngrktvvftd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.95 Rfree 0.2780
    Matthews' coefficent 2.76 Rfactor 0.2336
    Waters 1013 Solvent Content 55.44

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3obi
    1. Assessment of ligand_binding residue predictions in CASP9
    T Schmidt, J Haas, TG Cassarino - Structure, Function, and , 2011 - Wiley Online Library
     
    2. Blind prediction of quaternary structures of homo-oligomeric proteins from amino acid sequences based on templates
    M Morita, M Kakuta, K Shimizu, S Nakamura - 2012 - hoajonline.com
     

    Protein Summary

    The protein NP_949368.1 is annotated as formyltetrahydrofolate deformylase. NP_949368.1 belongs to PFAM PF00551 Formyl_trans_N PF01842 ACT which is a Formyl transferase family that contains several enzymes involved in transfer of formyl group in various reactions.

     

    The monomer structure is shown below.

    MJ15949E_monomer.png

     

    The protein likely forms a tetramer in solution. Two orthogonal views of the tetramer are shown below.

    MJ15949E_tetramer1.png MJ15949E_tetramer2.png

     

     

    A DALI search returns several very close structures, as shown below in the table.

    Top 10 DALI Structural Homologs
    N PDB Z-score RMSD LALI NRES %ID Description (JCSG structures highlighted in red)
    1 3lou 37.3 1.3 280 281 52 Formyltetrahydrofolate Deformylase
    2 3n0v 35.8 1.3 278 279 46 Formyltetrahydrofolate Deformylase
    3 1men 22.0 2.3 194 201 26 Phosphoribosylglycinamide Formyltransferase
    4 1rc1 21.7 2.3 192 200 26 Phosphoribosylglycinamide Formyltransferase
    5 1rby 21.7 2.4 193 200 26 Phosphoribosylglycinamide Formyltransferase
    6 1rbq 21.7 2.4 193 200 26 Phosphoribosylglycinamide Formyltransferase
    7 1njs 21.7 2.4 193 200 26 Phosphoribosylglycinamide Formyltransferase
    8 1rbm 21.6 2.4 193 200 26 Phosphoribosylglycinamide Formyltransferase
    9 1rc0 21.5 2.4 193 200 26 Phosphoribosylglycinamide Formyltransferase
    10 1zly 21.4 2.4 193 200 26 Phosphoribosylglycinamide Formyltransferase

     

    A superposition of NP_949368.1 (green) with 3lou (magenta) is shown below.

    MJ15949E_3lou.png

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch