.
The Open Protein Structure Annotation Network
PDB Keyword
.

3oqp

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a putative isochorismatase (Bxe_A0706) from BURKHOLDERIA XENOVORANS LB400 at 1.22 A resolution. To be published
    Site JCSG
    PDB Id 3oqp Target Id 399144
    Molecular Characteristics
    Source Burkholderia xenovorans lb400
    Alias Ids TPS29690,YP_560280.1, _0013.001003_ Molecular Weight 22315.72 Da.
    Residues 210 Isoelectric Point 5.94
    Sequence mttprralividvqneyvtgdlpieypdvqsslaniaramdaaraagvpvvivqnfapagsplfargsn gaelhpvvserardhyvekslpsaftgtdlagwlaarqidtltvtgymthncdastinhavhsglavef lhdatgsvpyensagfasaeeihrvfsvvlqsrfaavastdewiaavqggtplargniyasnqkararr ata
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.22 Rfree 0.1664
    Matthews' coefficent 1.90 Rfactor 0.1400
    Waters 489 Solvent Content 35.27

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3oqp
    1. Crystal structure of a putative isochorismatase hydrolase from Oleispira antarctica
    AM Goral, KL Tkaczuk, M Chruszcz, O Kagan - Journal of Structural and , 2012 - Springer
     

    Protein Summary

    YP_560280.1 is annotated as Putative isochorismatase hydrolase. YP_560280.1 belongs to PFAM PF00857 Isochorismatase, which has many other structures. According to NCBI refseq, the catalytic triad is given by residues D-12, K-88, Cys-121. In this protein structure, the latter has been modified to cysteine sulfinic acid, CSW.

    The monomer and dimer structures are shown below.

    MI0968C_mon.png MI0968C_dim.png

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch