.
The Open Protein Structure Annotation Network
PDB Keyword
.

3orj

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a sugar-binding protein (BACOVA_04391) from Bacteroides ovatus at 2.16 A resolution. To be published
    Site JCSG
    PDB Id 3orj Target Id 416764
    Molecular Characteristics
    Source Bacteroides ovatus atcc 8483
    Alias Ids TPS45739,ZP_02067384.1, 341305 Molecular Weight 47811.59 Da.
    Residues 438 Isoelectric Point 4.31
    Sequence dddddnggssvmnitgiyledaksnvpdrlvdfarlgqliriegegfnglkkvyingyncyfnpvfvsn ksflvsvnskvptteadenvrntirlvkdggeyvydfqiraaapsitkisncmpnvgepiivygsglte iakvvfpgnvvvtegiisdldgeyfmvdmpagvseeggsifvegsnggayspayfnykkglllnfdgvg aqgawgdsesmiqttelesasigegnvsqgaycrlplerqlpvaaaknrcaevwtagngtdpdwltlgv paetpvaecaiqfeiyvpepwsesgflkicgqngfnggewerdcynyvpwlvdgkivpfqttgwqtvtv pfsefykskassgawttfadvtatrasasyanfgfyfensditldkitgassdketeflskatsvkiyi dnwrvvpltkpeytdfpdeeedae
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.16 Rfree 0.2286
    Matthews' coefficent 2.64 Rfactor 0.1955
    Waters 276 Solvent Content 53.40

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3orj
    1. Multi-domain carbohydrate-binding proteins involved in Bacteroides thetaiotaomicron starch metabolism
    EA Cameron, MA Maynard, CJ Smith, TJ Smith - Journal of Biological , 2012 - ASBMB
     

    Protein Summary

    This protein is located next to a SusD in a sus operon. This operon consists of a HK (histidine kinase), a outer membrane receptor, SusD, this protein, and additional enzymes processing carbohydrates. This protein is functionally related to sugar metabolism in Bacteroides ovatus.

     

    The structure consists of three domains, the first two domains are homologous to each other, the last one is a PKD domain. All these domains are found in other carbohydrate processing enzymes, suggest that this protein is likely to bind sugar substrate.

     

    Of note, the B. thetaiotaomicron homolog (BT_3668) is highly over-expressed in the presence of host and simple sugar diet (GDS1849), suggesting a potential role in host-symbiont interactions. Further support for this hypothesis is provided by remote homology (FFAS score -31) with hepatocyte growth factor receptor, fibrocystin (FFAS score -29) and plexin B1 (FFAS score -29).

     

    Fig. 1. monomer

    sp16814a.png

    Fig. 2. surface

    sp16814a-surf.png

    Ligand Summary

    Reviews

    References

     

    No references found.

    Files (2)

    FileSizeDateAttached by 
     sp16814a-surf.png
    SP16814a-surf
    254.8 kB17:39, 30 Jul 2010qxuActions
     sp16814a.png
    SP16814a
    98.49 kB17:39, 30 Jul 2010qxuActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch