.
The Open Protein Structure Annotation Network
PDB Keyword
.

3os7

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a galactose mutarotase-like protein (CA_C0697) from CLOSTRIDIUM ACETOBUTYLICUM at 1.80 A resolution. To be published
    Site JCSG
    PDB Id 3os7 Target Id 397745
    Molecular Characteristics
    Source Clostridium acetobutylicum atcc 824
    Alias Ids TPS29616,NP_347334.1, _0078.001791_, _0004.003959_, _0003.003178_, 334594 Molecular Weight 38856.18 Da.
    Residues 340 Isoelectric Point 7.01
    Sequence mnnkdlwikeeiiwsehkcirfaaggyealiipdvggnvvelkdtnkgvtilrtpkkdlkfedfknrpq vyglpvlfppnriddgtfklgdktykfpineaknnnyihgfiknskwtvhkkkidqdkalvevvfdftk eneaykyfshefqfklsyelsskglkqttsvvnlsseemplsvgyhsafnvpfiegsedsncrvkisid kfwkqdsrnlptgesfaptgeqkeylengvavashpieslfslkdidvngktfrgaciedaskntrvvy emsseykylviwndmgdkkyaciepqtsiinspnvkldrsvsgfktlkpneswsgvcklyienm
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.80 Rfree 0.1808
    Matthews' coefficent 2.55 Rfactor 0.1428
    Waters 1693 Solvent Content 51.86

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3os7
    1. Assessment of ligand_binding residue predictions in CASP9
    T Schmidt, J Haas, TG Cassarino - Structure, Function, and , 2011 - Wiley Online Library
     
    2. Recognizing protein-ligand binding sites by global structural alignment and local geometry refinement
    A Roy, Y Zhang - Structure, 2012 - Elsevier
     
    3. Blind prediction of quaternary structures of homo-oligomeric proteins from amino acid sequences based on templates
    M Morita, M Kakuta, K Shimizu, S Nakamura - 2012 - hoajonline.com
     

    Protein Summary

    GalM from Clostridium acetobutylicum, a homolog of BsGalM (30% seq id). The structure was solved in complex with tartrate in the active site. An addition binding site occupied by PEG suggests a possible of a secondary binding site. See BsGalM page for further anotations.

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch