.
The Open Protein Structure Annotation Network
PDB Keyword
.

3osd

    Title Crystal structure of a putative glycosyl hydrolase (BT2157) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution. To be published
    Site JCSG
    PDB Id 3osd Target Id 417175
    Molecular Characteristics
    Source Bacteroides thetaiotaomicron vpi-5482
    Alias Ids TPS47444,NP_811070.1, 397315 Molecular Weight 29537.28 Da.
    Residues 264 Isoelectric Point 4.81
    Sequence gsaqeeqsanevavsyskslkaaemdslqlpvdadgyitifdgktfngwrgygkdrvpskwtiedgcik fngsgggeaqdgdggdlifahkfknfelemewkvskggnsgifylaqevtskdkdgndvlepiyisape yqvldndnhpdaklgkdnnrqsaslydmipavpqnakpfgewnkakimvykgtvvhgqndenvleyhlw tkqwtdllqaskfsqdkwplafellnncggenhegfigmqdhgddvwfrnirvkvld
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.80 Rfree 0.1836
    Matthews' coefficent 3.11 Rfactor 0.1595
    Waters 402 Solvent Content 60.43

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    The protein NP_811070.1 is annotated as hypothetical protein BT2157. NP_811070.1 belongs to PFAM PF06439 DUF1080, a family of unknown proteins.

     

    However, a structure comparison (see DALI results below) suggests that this protein could be a putative sugar or glycosyl hydrolase.

    The structure of the protein is displayed below.

    SP13645C.png

     

    Top 10 DALI Structural Homologs
    N PDB Z-score RMSD LALI NRES %ID Description (JCSG structures highlighted in red)
    1 3h3l 30.5 1.4 208 223 55 Putative Sugar Hydrolase
    2 3hbk 28.8 1.7 214 231 38 Putative Glycosyl Hydrolase
    3 3imm 21.0 2.2 187 197 23 Putative Secreted Glycosylhydrolase
    4 1oq1 14.2 3.0 179 223 12 Protein Yesu
    5 3d6e 13.6 2.8 164 186 10 Beta-glucanase
    6 2a6x 12.5 2.7 163 219 7 Emp46p
    7 2a6w 12.5 2.8 165 219 8 Emp46p
    8 2a6v 12.5 2.8 164 217 8 Emp46p
    9 3fby 12.3 4.4 168 535 11 Cartilage Oligomeric Matrix Protein
    10 1u0a 12.3 2.7 156 214 12 Beta-glucanase

     

    A comparison with 3h3l and 3hbk highlight the extensive structural similarities of this protein with the Sugar and Glycosyl hydrolases.

    SP13645C_3h3l_3hbk.png

    NP_811070.1 (green), 3h3l (magenta) and 3hbk (blue).

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch