.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ot2

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a putative nuclease belonging to DUF820 (Ava_3926) from Anabaena variabilis ATCC 29413 at 1.96 A resolution. To be published
    Site JCSG
    PDB Id 3ot2 Target Id 399397
    Molecular Characteristics
    Source Anabaena variabilis atcc 29413
    Alias Ids TPS29726,YP_324426.1, _0005.000700_, 332940 Molecular Weight 21122.12 Da.
    Residues 186 Isoelectric Point 4.91
    Sequence mvqtpskpitldeflklpetepaseyiegkiiqkpmpqgkhsaiqsecvsvinsvvkpqriaraflelr ctfgdhstvpdisvfiwsripreengeianifliapdwtieilspdqsqtkvtknilhclkhgtqmgwl idpdeqtvfvyrpqqetevfdepdalvpvpsfaselhlsikdlfswll
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.96 Rfree 0.239
    Matthews' coefficent 3.34 Rfactor 0.216
    Waters 285 Solvent Content 63.17

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3ot2
    1. Blind prediction of quaternary structures of homo-oligomeric proteins from amino acid sequences based on templates
    M Morita, M Kakuta, K Shimizu, S Nakamura - 2012 - hoajonline.com
     

    Protein Summary

    This is a member of DUF820. It shares similar structure with 1wdj, a possible nuclease (rmsd 2.0A for 163 aligned Ca, 17% seq id) [Ref]. However, not all residues near the putative nuclease active are conserved (D80/Q45/E110/L112 vs DExEK). It is also homologous to 3ijm (MCSG) with rmsd 2.2A for 119 Ca, 12% seq id.

     

    This family of putative nucleases are highly abundant in cyanobacteria.

     

    Fig 1. monomer

    mi15921e-monomer.png

    Fig 2. dimer

    mi15921e.png

    Ligand Summary

    Reviews

    References

     

    1. (No Results)

       


      Discuss this publication
    Tag page
    • No tags

    Files (2)

    FileSizeDateAttached by 
     mi15921e-monomer.png
    mi15921e monomer
    123.23 kB16:16, 30 Aug 2010qxuActions
     mi15921e.png
    mi15921e dimer
    139.88 kB16:16, 30 Aug 2010qxuActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch