.
The Open Protein Structure Annotation Network
PDB Keyword
.

3p1t

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a putative aminotransferase (BPSL1724) from Burkholderia pseudomallei K96243 at 2.60 A resolution. To be published
    Site JCSG
    PDB Id 3p1t Target Id 390542
    Molecular Characteristics
    Source Burkholderia pseudomallei k96243
    Alias Ids TPS14581,YP_108324.1, 3.40.640.10, 85637 Molecular Weight 37181.84 Da.
    Residues 336 Isoelectric Point 5.70
    Sequence msvgeamdtevraaaqavclafnenpeaveprvqaaiaaaaarinrypfdaeprvmrklaehfscpedn lmlvrgidecfdrisaefssmrfvtawpgfdgyrariavsglrhfeigltddllldpndlaqvsrddcv vlanpsnptgqalsageldqlrqragkllidetyvdyssfrarglaygenelvfrsfsksyglaglrlg alfgpseliaamkrkqwfcnvgtldlhaleaaldndrareahiaktlaqrrrvadalrglgyrvassea nfvlvenaagertlrflrergiqvkdagqfglhhhirisigreedndrllaalaeysdhs
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.60 Rfree 0.234
    Matthews' coefficent 3.39 Rfactor 0.200
    Waters 568 Solvent Content 63.74

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3p1t
    1. Assessment of ligand_binding residue predictions in CASP9
    T Schmidt, J Haas, TG Cassarino - Structure, Function, and , 2011 - Wiley Online Library
     
    2. Blind prediction of quaternary structures of homo-oligomeric proteins from amino acid sequences based on templates
    M Morita, M Kakuta, K Shimizu, S Nakamura - 2012 - hoajonline.com
     

    Protein Summary

     Pfam Update: This protein is in family: Aminotran_1_2 (PFAM:PF00155). There are many other structures in this family.

     

    Targetid 390542 is a member of the Aminotran_1_2 Pfam family. This fa,mily is represented by 450 structures in the PDB. MG14544A is a putative histidinol-phosphate aminotransferase (EC:2.6.1.9 (EC 2.6.1.9). Shown below is a ribbons representation of the structure of target ID 390542 with the N-terminal end in blue and the C-terminal end in red.

     

    monomer.png

     

     The structure of six histidinol phosphate aminotransferase has been determined from structual genomics centers.  Those structures from JCSG include PDB ID 2faj, 3euc, and 3get.

     

     

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (1)

    FileSizeDateAttached by 
     monomer.png
    No description
    162.76 kB18:23, 21 Sep 2010haxelrodActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch