.
The Open Protein Structure Annotation Network
PDB Keyword
.

3p1u

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a SusD homolog (YP_001301998.1) from Parabacteroides distasonis ATCC 8503 at 2.05 A resolution. To be published
    Site JCSG
    PDB Id 3p1u Target Id 394774
    Molecular Characteristics
    Source Parabacteroides distasonis atcc 8503
    Alias Ids TPS25358,YP_001301998.1 Molecular Weight 59240.28 Da.
    Residues 528 Isoelectric Point 5.10
    Sequence nenpdkptddvnynmneprlastlrggliiegnveqrlkplqidfysqmtvdgggwgtknyiqddewnn lvweeylkqiasinivirsltekdkdayantiafariwrvyvhtlaadkfgpmpfpayeiveanppyks lkdiydeyfreldaaingfndsaqpifsdagidliykndvskwkrfanslrlrlavrltevdqekciae anaaisspaglisdkadnaymppkadgswgqdynytmfqitwsgpicmsksveklvtniggvawpqgvv nqtsgvavssvhpekvdprapkifqpgiengdwkglvygpkaeeantgiyqskqcaelgfiikdgypyk srpydlflseevhflkaelyargfiagdakseyeagvrasfatwgvtsevddyltstekneagtsaryd dqqgagntalekiitqkyiagipdlaqegwndkrrlnlprldvavyrdqavynnndkdilksanfikrm ryptkeslinateyekgksmlggkgdivstplwwdknsnyctssk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.05 Rfree 0.265
    Matthews' coefficent 2.35 Rfactor 0.243
    Waters 592 Solvent Content 47.72

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3p1u
    1. The retinoid X receptors and their ligands
    MI Dawson, Z Xia - Biochimica et Biophysica Acta (BBA)-Molecular and , 2011 - Elsevier
     

    Protein Summary

    Pfam: This protein very soon overlaps with SusD PF07980.

    The crystal structure of Target ID 394774 has been determined from a hexagonal crystal form to a resolution of 2.05 Angstroms using Se-MAD for primary phasing. A ribbon representation of the structure is shown below.

     

    monomer_ribbons.png

     

     

    A DALI search of the PDB database using the coordinates of target ID 394774 reveals structural similarity to the following. This is only the top-scoring hits.

     

     

    PDB ID
    Z-Score
    rmsd (Ang)
    length alignment
    number residues
     % sequence id
    Description
    3gzs 40.6 2.1 444 495 27
    SusD superfamily protein (YP_213019.1) from Bacteroides fragilis NCTC 9343 at 2.1 Ang Resolution 
    3ehm 39.4 2.3 456 510 25 Structure of a Sus D homolog, BT1043, involved in mucin O-glycan utilization in a prominent human gut symbiot.
    3cgh 38.3 2.3 441 507 26 SusD homolog (NP_812895.1) from Bacteroides thetaiotaomicron VPI-5482 at 1.70 Ang resolution.
    3ejn 32.5 2.7 414 450 20 SusD homolog (YP_212639.1) from Bacteroides fragilis NCTC 9343 at 1.50 Ang resolution.
    3fdh 30.8 3.0 412 472 21 SusD homolog (NP_810946.1) from Bacteroides thetaiotamicron VPI-5482 at 1.75 Ang resolution
    3jq1 22.8 2.8 360 464 12 SusD superfamily protein (YP_001297730.1) from Bacteroides vulgatus ATCC 8482 at 1.55 Ang resolution.
    3jys 22.5 3.3 384 479 13 SusD superfamily protein (YP_120098690.1) from Bacteroides vulgatus ATCC 8482 at 2.00 Ang resolution.
    3mcx 22.1 3.1 369 459 14 SusD superfamily protein (BT_2365) from Bacteroides thetaiotaomicron VPI-5482 at 1.49 Ang resolution.
    3myv 21.9 3.2 364 445 10 SusD superfamily protein (BVU_0732) from Bacteroides vulgatus ATCC 8482 at 1.80 Ang resolution.
    3l22 21.9 3.2 349 429 17

    SusD superfamily protein (YP_210307.1) from Bacteroides fragilis NCTC 9343 at 2.05 Ang resolution

    3ckc 21.9 3.0 376 500 14 B. thetaiotamicron SusD

     

     

     

     

     

     

     

     

     

     

     

     

     

     

     

     

     

     

     

     

     

     

     

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (1)

    FileSizeDateAttached by 
     monomer_ribbons.png
    No description
    277.25 kB18:53, 7 Aug 2009haxelrodActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch