.
The Open Protein Structure Annotation Network
PDB Keyword
.

3p2c

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a putative glycosyl hydrolase (BACOVA_03347) from Bacteroides ovatus at 1.60 A resolution. To be published
    Site JCSG
    PDB Id 3p2c Target Id 416740
    Molecular Characteristics
    Source Bacteroides ovatus atcc 8483
    Alias Ids TPS33832,ZP_02066351.1, 341311 Molecular Weight 52695.54 Da.
    Residues 462 Isoelectric Point 6.64
    Sequence snrmtemhvcladaiqkdnrpeisnrlfrsnavekeilrvqkllknaklawmftncfpntldttvhfrk gsdgkpdtfvytgdihamwlrdsgaqvwpyvqlansdpelkemlagvilrqfkcinidpyanafndgai pdghwmsdltdmkpelherkweidslcyplrlayhywkttgdasifneewiqaitnvlktfkeqqrkdg vgpykfqrkteraldtvsndglgapvkpvglivssfrpsddattlqflvpsnffavsslrkaaeilekv nkktalskeckdlaqevetalkkyavynhpkygkiyafevdgfgnhhlmddanvpsllampylgdvnvn dpiyqntrrfvwsednpyffkgkagegiggphigydmvwpmsimmkaftsqndaeiktcikmlmdtdag tgfmhesfhkdnpkkftrawfawqntlfgelilklvnegkvdllnsiq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.60 Rfree 0.1682
    Matthews' coefficent 2.36 Rfactor 0.1339
    Waters 1158 Solvent Content 47.93

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3p2c
    1. Analysis of a New Family of Widely Distributed Metal-independent _-Mannosidases Provides Unique Insight into the Processing of N-Linked Glycans
    KJ Gregg, WF Zandberg, JH Hehemann - Journal of Biological , 2011 - ASBMB
     

    Protein Summary

     This protein is annotated as a member of Pfam PF06824 (DUF1237), with unknown function. The 264 proteins in this family are found in bacteria (176 proteins from 142 species) as well as eukaryotes (81 proteins from 53 species). Of the 176 bacterial proteins, the largest number are present in Bacteroidetes (37 proteins) and in Firmicutes (106 proteins).

    It is present as a dimer in the crystal structure:

    Fig1.png

    Another structure of a close homolog has been solved recently by JCSG with PDB id 3on6 and more information is available at the TOPSAN entry for 3on6.

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (1)

    FileSizeDateAttached by 
     Fig1.png
    No description
    657.57 kB23:17, 28 Sep 2010debanuActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch