The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a Sugar phosphate isomerase/epimerase (BDI_1903) from Parabacteroides distasonis ATCC 8503 at 1.85 A resolution. To be published
    Site JCSG
    PDB Id 3p6l Target Id 396614
    Molecular Characteristics
    Source Parabacteroides distasonis atcc 8503
    Alias Ids TPS27944,YP_001303260.1, 333081 Molecular Weight 29892.66 Da.
    Residues 261 Isoelectric Point 7.19
    Sequence qtkaekngwrlgmqsysfhlfpltealdktqelglkyieiypghklggkwgdkvfdfnldaqtqkeike laaskgikivgtgvyvaekssdwekmfkfakamdlefitcepalsdwdlveklskqynikisvhnhpqp sdywkpenllkaisgrsqslgscsdvghwrreglnqidclkqlkgriislhfkdiapkkageneqhdvi wgtgildvkgmlkelksqnfkgvfsieyeynwensvpdikeciqyfnktaneil
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.85 Rfree 0.2385
    Matthews' coefficent 2.30 Rfactor 0.1862
    Waters 180 Solvent Content 46.54

    Ligand Information



    Protein Summary

    This protein from Parabacteroides distasonis atcc 8503 is annotated as a member of PFAM:PF01261, the xylose isomerase-like TIM barrel proteins of AP_endonuclease_2 family. 

    The protein is present as a monomer in the crystal structure:


    Phosphate, PEG and Citrate from the crystallization solution have been modeled in the solvent structure. The citrate molecule is surrounded by histidines, asparates, a glutamine and tyrosine residues.

    Crystal packing analysis suggests that that the bound phosphate mediates a dimer packing in the crystal structure:


    JCSG has also solved the structure of another homolog from the same organism with 22% sequence id, PDB:3lmz and its description can be found in its TOPSAN page.

    The 3lmz protein (cyan) also has a citrate molecule at the same site as this protein (red):


    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (3)

    FileSizeDateAttached by 
    No description
    423.5 kB17:28, 27 Sep 2010debanuActions
    No description
    119.15 kB17:49, 27 Sep 2010debanuActions
    No description
    456.15 kB18:13, 27 Sep 2010debanuActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch