.
The Open Protein Structure Annotation Network
PDB Keyword
.

3pas

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a TetR family transcription regulator (Maqu_1417) from MARINOBACTER AQUAEOLEI VT8 at 1.90 A resolution. To be published
    Site JCSG
    PDB Id 3pas Target Id 403168
    Molecular Characteristics
    Source Marinobacter aquaeolei vt8
    Alias Ids TPS30644,YP_958691.1, _0088.001719_, 324424 Molecular Weight 22315.09 Da.
    Residues 194 Isoelectric Point 6.31
    Sequence mrqrddskriafleatvrevadhgfsatsvgkiakaaglspatlyiyyedkeqlllatfyyvsdqvida aldsfsrgkdlreglrrqwhtlfriglerpelfryhetfthsawmtpeiqarnesraanllnavdqgkq sglikpvpfplletfmfrpiyhlvqrclqgsfegtdehielafnmawdavadrrnt
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.90 Rfree 0.2107
    Matthews' coefficent 2.31 Rfactor 0.1671
    Waters 470 Solvent Content 46.86

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    Pfam update: This sequence has no other Pfam domains on it other than the TetR_N at the N-terminus. 

    There are 4 protein molecules in the asymmetric unit of the crystal structure, but crystal structure analysis supports the assingment of a dimer as the significant oligomeric state:

    Fig1.png

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (1)

    FileSizeDateAttached by 
     Fig1.png
    No description
    328.46 kB18:16, 11 Aug 2010debanuActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch