.
The Open Protein Structure Annotation Network
PDB Keyword
.

3pf0

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of an Imelysin-like protein (Psyc_1802) from PSYCHROBACTER ARCTICUM 273-4 at 2.15 A resolution. To be published
    Site JCSG
    PDB Id 3pf0 Target Id 406062
    Molecular Characteristics
    Source Psychrobacter arcticus 273-4
    Alias Ids TPS58278,YP_265084.1, PF04302, 332285 Molecular Weight 38485.67 Da.
    Residues 363 Isoelectric Point 4.53
    Sequence ddnnaaevdrqvaqdsaepktgenaaagdssstnknaekivavdisaetektylthvandmvipayada akqsdllhdlaqkhcqkapvsgdelqalrdqwlvlaqawasaemvnfgpatasmsnlyinyypderglv hggvadlitanpaltaeqlanesavvqgipgleealyandsldagqcayvmsassalgtrlkdieknwq qnaikllaidktaesdqglnqwfnsllslvetmksnaieqplglsgkakghlpaatagqsraiinakla tlnkamtdpvltailgsnnentvadtlstaladttallaqmpedlatadkatqqelydhltnitrliks qliptlgirvgfnstdgd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.15 Rfree 0.2176
    Matthews' coefficent 2.22 Rfactor 0.1823
    Waters 222 Solvent Content 44.70

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3pf0
    1. Structural and Sequence Analysis of Imelysin-Like Proteins Implicated in Bacterial Iron Uptake
    Q Xu, ND Rawlings, CL Farr, HJ Chiu, JC Grant - PloS one, 2011 - dx.plos.org
     
    2. Crystal structure of bacterial cell-surface alginate-binding protein with an M_75 peptidase motif
    Y Maruyama, A Ochiai, B Mikami, W Hashimoto - Biochemical and , 2011 - Elsevier
     

    Protein Summary

    This protein has a cannonical imelysin fold, but the HXXE motif is modified with the replacement of His by Pro. 

    This structure is related to other JCSG structures PDB:3oyv (topsan) and PDB:3n8u (topsan).

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch