.
The Open Protein Structure Annotation Network
PDB Keyword
.

3pl2

    Title Crystal structure of a 5-keto-2-deoxygluconokinase (NCgl0155, Cgl0158) from Corynebacterium glutamicum ATCC 13032 KITASATO at 1.89 A resolution. To be published
    Site JCSG
    PDB Id 3pl2 Target Id 375206
    Molecular Characteristics
    Source Corynebacterium glutamicum atcc 13032
    Alias Ids TPS6839,NP_599410.1, 3.40.1190.20, 285320 Molecular Weight 34745.17 Da.
    Residues 318 Isoelectric Point 4.69
    Sequence mtnltsthevlaigrlgvdiyplqsgvgladvqsfgkylggsaanvsvaaarhghnsallsrvgndpfg eyllaelerlgvdnqyvatdqtfktpvtfceifppddfplyfyrepkapdlniesadvslddvreadil wftltgfseepsrgthreilttranrrhtifdldyrpmfwespeeatkqaewalqhstvavgnkeecei avgeteperagrallergvelaivkqgpkgvmamtkdetvevppffvdvinglgagdafggalchglls ewplekvlrfantagalvasrlecstampttdeveaslnqkv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.89 Rfree 0.2252
    Matthews' coefficent 2.07 Rfactor 0.1805
    Waters 577 Solvent Content 40.47

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    The protein NP_599410.1 is annotated as sugar kinases, ribokinase family. NP_599410.1 belongs to PFAM PF00294 PfkB. This consists of carbohydrate and pyrimidine kinases.

    The monomer structure and biological dimer are shown below.

    RK10655A.png RK10655A_dimer.png

     

    There are many similar structures already available in PDB (see DALI table below). This structure was solved by Molecular Replacement method using the JCSG structure 2qcv as a search template.

     

    DALI Structural Homologs
    N PDB Z-score RMSD LALI NRES %ID Description (JCSG structures highlighted in red)
    1 2qcv 42.3 1.6 303 325 27 Putative 5-dehydro-2-deoxygluconokinase
    2 2var 41.7 1.7 303 311 24 Fructokinase
    3 2v78 41.6 1.8 303 311 24 Fructokinase
    4 2dcn 41.2 1.8 301 308 25 Hypothetical Fructokinase
    5 1wye 41.0 1.8 301 309 25 2-keto-3-deoxygluconate Kinase
    6 1v1a 38.7 2.0 296 301 28 2-keto-3-deoxygluconate Kinase
    7 1v1b 38.3 2.0 295 300 27 2-keto-3-deoxygluconate Kinase
    8 3iq0 38.1 2.3 303 308 22 Putative Ribokinase Ii
    9 1v19 38.1 2.1 296 301 28 2-keto-3-deoxygluconate Kinase
    10 3k9e 37.9 2.4 306 311 22 Putative Ribokinase Ii

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (2)

    FileSizeDateAttached by 
     RK10655A.png
    No description
    146.29 kB21:03, 29 Oct 2010abhinavkActions
     RK10655A_dimer.png
    No description
    249.54 kB21:03, 29 Oct 2010abhinavkActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch