.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ppb

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a putative tetR family transcription regulator (Shew_3104) from SHEWANELLA SP. PV-4 at 2.10 A resolution. To be published
    Site JCSG
    PDB Id 3ppb Target Id 399313
    Molecular Characteristics
    Source Shewanella sp. pv-4
    Alias Ids TPS30592,YP_001095229.1, 324923 Molecular Weight 21725.50 Da.
    Residues 194 Isoelectric Point 6.15
    Sequence mtasskrtkkqailetalqlfvsqgfhgtstatiareagvatgtlfhhfpskeqlleqlflgvkqefad aiqasvssrgdlkqdaeqlwfaaltwamanplkqaffqlysmsptveqsvrdqamhgilgfiaelirqg qasgelaeypielmqdnchgqylaatryfvdhperwqqahersasfalfwnamavr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.10 Rfree 0.2093
    Matthews' coefficent 2.11 Rfactor 0.1742
    Waters 129 Solvent Content 41.83

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    Pfam update: This sequence has just the short N-terminal TetR_N domain PF00440 on it but the rest of the molecule is uncharacterised. This should be interesting.

    The protein is a dimer like other TetR family proteins. a PEG-400 fragment, PG4, from the crystallization solution has been modeled at the putative ligand binding site (pink spheres).

    Fig1.png

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (1)

    FileSizeDateAttached by 
     Fig1.png
    No description
    415.21 kB20:32, 14 Sep 2010debanuActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch