.
The Open Protein Structure Annotation Network
PDB Keyword
.

3pvq

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a putative dipeptidyl-peptidase VI (BT_1314) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution. To be published
    Site JCSG
    PDB Id 3pvq Target Id 417194
    Related PDB Ids 4r0k 
    Molecular Characteristics
    Source Bacteroides thetaiotaomicron vpi-5482
    Alias Ids TPS47448,NP_810227.1, PF00877, 324383 Molecular Weight 35029.75 Da.
    Residues 307 Isoelectric Point 6.33
    Sequence qeirpmpadsaygvvhisvcnmrdegkftsgmstqallgmpvkvlqytgwyeiqtpddytgwvhrmvit pmskekydewnraekivvtshygftyekpdddsqtvsdvvagnrlkwegskghfykvsypdgrqayisr hisqpeskwraslkqdaesiiktaytmigipylwagtsskgvdcsglvrtvlfmhdiiiprdasqqayv gerieiapdfsnvqrgdlvffgrkatadrkegishvgiylgnkrfihalgdvhissfdpedecydefnt grllfatrflpyinkekgmnttdhnlyylhh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.10 Rfree 0.1982
    Matthews' coefficent 2.46 Rfactor 0.1647
    Waters 450 Solvent Content 49.96

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    This protein is very similar to other NlpC/P60 proteins JCSG have determined [3npf (seq id 88%), 3h41,2evr etc]. The structural analysis of 3h41 was published recently [Ref].

    Ligand Summary

    Reviews

    References

     

    1. (No Results)

       


      Discuss this publication
    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch