.
The Open Protein Structure Annotation Network
PDB Keyword
.

3pxp

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of an MmyB-Like Regulator from C. aurantiacus, Member of a New Transcription Factor Family Linked to Antibiotic Metabolism in Actinomycetes. Plos One 7 e41359-e41359 2012
    Site JCSG
    PDB Id 3pxp Target Id 369930
    Molecular Characteristics
    Source Chloroflexus aurantiacus j-10-fl
    Alias Ids TPS6410,YP_001635876.1, 103772, 103333 Molecular Weight 33888.09 Da.
    Residues 291 Isoelectric Point 6.41
    Sequence meraafgklvqalrrehrdekgrvwtqevlaertqlpkrtieriengslahldadillrladaleltig errefffaatgiieqksatykrspeeslqylidmirnmnvpafvtdqyvniiaanmitirffnipmeli etapllphgynlmrvvfgteydfrrvvgtmwdevarhnmqlfraislrvradgyfvelldnlmqyrefk rfwerahletedtsaenfwyqythpvygllsyvssrsqiptsmgllsmhtyiplspattdlfaklstva nqdvirlapwprsng
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.30 Rfree 0.206
    Matthews' coefficent 2.45 Rfactor 0.168
    Waters 611 Solvent Content 49.84

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3pxp
    1. Structure of an MmyB-Like Regulator from C. aurantiacus, Member of a New Transcription Factor Family Linked to Antibiotic Metabolism in Actinomycetes
    Q Xu, GP van Wezel, HJ Chiu, L Jaroszewski, HE Klock - PloS one, 2012 - dx.plos.org
     

    Protein Summary

    The Caur_2278 (GI:163847832, accession YP_001635876.1, refseq NC_010175.1) protein from Chloroflexus aurantiacus J-10-fl belongs to the Xre (NOTE: Xre is a protein name, not xenobiotic response element) transcription factor family, and contains a N-terminal Xre HTH domain and a C-terminal PAS-like domain.  This is a large (>1000 members) family of proteins, found in very diverse bacteria, from proteobacteria to firmicutes to actinobacteria. The PAS-domain has a myristic acid in the substrate binding site.

     

    The protein in the crystal is a dimer, it is speculated that dimer is promoted by ligand binding of the PAS domain.

     

    Fig. 1. dimer with fatty acid (shown as sticks)

    fj9298a.png

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (1)

    FileSizeDateAttached by 
     fj9298a.png
    fj9298a dimer
    194.21 kB20:29, 2 Nov 2010qxuActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch