.
The Open Protein Structure Annotation Network
PDB Keyword
.

3qbm

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a TetR transcriptional regulator (Caur_2221) from CHLOROFLEXUS AURANTIACUS J-10-FL at 1.80 A resolution. To be published
    Site JCSG
    PDB Id 3qbm Target Id 399264
    Molecular Characteristics
    Source Chloroflexus aurantiacus j-10-fl
    Alias Ids TPS29702,YP_001635819.1, _0111.000795_, _0090.002210_, _0081.003627_, _0114.002261_, _0076.003088_, _0052.002647_, 327917 Molecular Weight 21864.87 Da.
    Residues 198 Isoelectric Point 5.98
    Sequence mrkgqetrervvaqaaalfnvsgyagtaisdimaatglekggiyrhfeskeqlalaafdyaaekvrerf avglaghkhtvdtiiafldvfrsyaerpplvggcpilntaiesddtnpmlrervravidewretirtlv qtgiargeirpevdadrlalliiatmegavmlariletatplehaythlatyitqqvrla
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.80 Rfree 0.2132
    Matthews' coefficent 2.21 Rfactor 0.1647
    Waters 321 Solvent Content 44.41

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    This protein has the structure of a TetR family transcription factor (Pfam PF00440).

    It is present as a dimer:

    Fig1.png

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (1)

    FileSizeDateAttached by 
     Fig1.png
    No description
    460.16 kB19:51, 12 Oct 2010debanuActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch