.
The Open Protein Structure Annotation Network
PDB Keyword
.

3qnk

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a Hypothetical SusD-like protein (BF3747) from Bacteroides fragilis NCTC 9343 at 2.70 A resolution. To be published
    Site JCSG
    PDB Id 3qnk Target Id 396575
    Molecular Characteristics
    Source Bacteroides fragilis nctc 9343
    Alias Ids TPS25937,YP_213337.1, BIG_773, 332901 Molecular Weight 60117.18 Da.
    Residues 516 Isoelectric Point 4.91
    Sequence kapldeiaddsfwsdetlvkyyvndlyseisvdglqlqenrsdnsvsaqrdkyraswfkfnydmvsasd pqdddvwedyyvkvrkcnrfferigtstieeseksrltgevhflramfyfemvkryggvilldkvltme dnweiprssekecydfiledlkkatemlpasygsrekgratkgaayalksrvelydkryedvikscaev yklgyelvdgttpekyrsiwwttnkdnkeiifdvqykspdvynnmmvcnmvtyindkygdrgwgglgpt qelidafemadgtpatqysqapadqvfdintcgiyegreprfyanivfhgsqiffnadkgavtvdrylm dtpdkgdgsltgynvwkwidydnynypyagagspdfstnwiilryaeiylndaearletgdvegarkav nmirqrvglpdltesdpeklrelirkerriefafeeqrfydvrrwkigpetqttlhgvrfvsptefkvt ktdirtwndrlyltpvphdeivrssvlkqnlgy
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.70 Rfree 0.2113
    Matthews' coefficent 2.89 Rfactor 0.1833
    Waters 72 Solvent Content 57.42

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    Pfam update: This protein hits the SusD family with a high significance. The function of the domain is unknown even though it is in the TPR repeat clan and has several structures known already. 

    JCSG has solved numerous structures from this family. See this Topsan page for 3otn.pdb for a brief summary and PDB ids of some of the other structures.

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch