.
The Open Protein Structure Annotation Network
PDB Keyword
.

3qta

    Title Crystal structure of a Hypothetical CheC-like protein (rrnAC0528) from HALOARCULA MARISMORTUI ATCC 43049 at 2.00 A resolution. To be published
    Site JCSG
    PDB Id 3qta Target Id 403041
    Molecular Characteristics
    Source Haloarcula marismortui atcc 43049
    Alias Ids TPS30770,YP_135254.1, _0038.001290_, 322417 Molecular Weight 25043.63 Da.
    Residues 232 Isoelectric Point 4.08
    Sequence mpllidirkltlitrliqdgaeqvadslatlagvdaaveikslsfvqpediatemgggtiysarvrlte ppygvflmtfetetaaeiaelmtgssvedgftqlhesalqemcniltsgfidgiantlnatinmgtptv vqddateiadkalshvrrdsltivldslvdikesdvafslriflipdpgsfvhlidqldydtdrethis adtdavkeldmsgdadaldafdssk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.2023
    Matthews' coefficent 2.95 Rfactor 0.1748
    Waters 326 Solvent Content 58.24

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary

    It is likely to be a putative cheC/fliM- like protein

    Sequence analysis:
    HHpred, against pfam, top hit CheC-like family (PF04509, Prob 99.1, E-value 1.1E-11, P-value 9E-16), 2nd hit Flagellar motor switch
    protein FliM (PF02154, Prob 98.7, E-value 5.1E-07, P-value 4.3E-11) FFAS, againt pfam, Flagellar motor switch protein FliM (PF02154, score -21.700), 2nd hit CheC-like family (PF04509, score -17.000)

    Structural analysis:
    Dali, against PDB, top hit CHEMOTAXIS PROTEIN CHEC (PDB 1xkr-A, Z-score 21.2, rmsd 2.8, lali 195), 2nd hit CHEMOTAXIS PROTEIN CHEC (PDB 2f9z-A, z-score 19.5, rmsd 2.8, lali 184). 3rd hit FLAGELLAR MOTOR SWITCH PROTEIN FLIM (PDB 2hp7-A, Z-score 15.6, rmsd 3.1, lali 169)
     
    Note that CheC and FliM share a very similar topology. However, Flim lacks the phosphatase consensus motif present in CheC. A further analysis should be performed to discriminate between these two proteins.

    YP_135254.1 belongs to PFAM PF04509 CheC.

    The monomer and dimer structures are shown below.

    MJ11052C_mon.png  MJ11052C_dimer.png

    The top DALI hits are summarized in the table below.

    Top 10 DALI Structural Homologs
    N PDB Z-score RMSD LALI NRES %ID Description (JCSG structures highlighted in red)
    1 1xkr 21.2 2.8 195 205 18 Chemotaxis Protein Chec
    2 2f9z 19.5 2.8 184 193 18 Chemotaxis Protein Chec
    3 2hp7 15.6 3.1 169 179 7 Flagellar Motor Switch Protein Flim
    4 1xko 12.0 2.8 144 159 16 Chemotaxis Protein Chex
    5 1squ 11.8 2.9 142 154 15 Chex Protein
    6 3h4y 11.1 3.1 145 154 12 Putative Chemotaxis Protein
    7 3hm4 10.9 3.1 145 150 16 Chemotaxis Protein Chex
    8 3iic 10.6 3.2 144 154 18 Chec Domain Protein
    9 3hzh 10.6 3.6 147 154 14 Chemotaxis Response Regulator (chey-3)
    10 3h2d 9.6 3.7 144 154 15 Chec-like Superfamily Protein

    A superposition of YP_135254.1 onto the first two DALI hits lends support to the assignment of this protein to be CheC.

    MJ11052c_1xkr_2f9z.png

    Color Scheme: YP_135254.1 (green), 1xkr (blue), 2f9z (magenta)
     

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch